Главная страница  |  Описание сайта  |  Контакты
МЕЧЕНЫЕ РАДИОАКТИВНЫМ ИЗОТОПОМ ПЕПТИДЫ ДЛЯ ДИАГНОСТИКИ И ТЕРАПИИ
МЕЧЕНЫЕ РАДИОАКТИВНЫМ ИЗОТОПОМ ПЕПТИДЫ ДЛЯ ДИАГНОСТИКИ И ТЕРАПИИ

МЕЧЕНЫЕ РАДИОАКТИВНЫМ ИЗОТОПОМ ПЕПТИДЫ ДЛЯ ДИАГНОСТИКИ И ТЕРАПИИ

Патент Российской Федерации
Суть изобретения: Изобретение относится к химико-фармацевтической промышленности и касается радиотерапевтических радиодиагностических реагентов и пептидов. Изобретение заключается в том, что реагенты для получения радиофармацевтического препарата включает рецептор-связывающий вазоактивный кишечный пептид (VIP), ковалентно связанный с хелатирующей составляющей технеция или рения. Изобретение относится к способам и наборам для получения, мечения и применения таких пептидов для радиодиагностических и радиотерапевтических целей. Изобретение в особенности относится к производным вазоактивным кишечным рецептор-связывающим пептидов, меченных технецием-99 m, использованию их в качестве сцинтиграфических отображающих агентов. Изобретение также в особенности относится к производным вазоактивным кишечных рецептор - связывающих пептидов и аналогам вазоактивных кишечных пептидов, меченных такими цитотоксичными радиоактивными изотопами, как рений-186 (186Re) и рений-188 (188Re) для использования в качестве радиотерапевтических агентов. Также пептидов диагностически и терапевтически в теле млекопитающего. Изобретение обеспечивает возможность для получения, радиолечения и терапевтического использования таких пептидов в теле млекопитающего. 6 с. и 5 з.п.ф-лы, 5 табл.
Поиск по сайту

1. С помощью поисковых систем

   С помощью Google:    

2. Экспресс-поиск по номеру патента


введите номер патента (7 цифр)

3. По номеру патента и году публикации

2000000 ... 2099999   (1994-1997 гг.)

2100000 ... 2199999   (1997-2003 гг.)
Номер патента: 2171117
Класс(ы) патента: A61K51/08, A61P43/00
Номер заявки: 97118152/14
Дата подачи заявки: 29.03.1996
Дата публикации: 27.07.2001
Заявитель(и): ДИАТАЙД, ИНК. (US)
Автор(ы): ДИН Ричард Т. (US); ПИРСОН Дэниел Э. (US); ЛИСТЕР-ДЖЕЙМС Джон (US); СИВИТЕЛЛО Эдгар Р. (US)
Патентообладатель(и): ДИАТАЙД, ИНК. (US)
Описание изобретения: Область использования
Изобретение относится к радиотерапевтическим агентам и пептидам, радиодиагностическим агентам и пептидам, и способам получения таких радиодиагностических и радиотерапевтических агентов. Более точно, настоящее изобретение относится к рецептор-связывающим вазоактивным кишечным пептидам (включая природный вазоактивный кишечный пептид (ВКП) и его фрагменты, производные аналоги и миметики) и соединениям, меченым изотопами, испускающими гамма-излучение, такими как технеций - 99m (Tc - 99m), а также к способам и оборудованию для получения, радиомечения и терапевтического использования таких пептидов в теле млекопитающего.
2. Уровень техники
Природный вазоактивный кишечный пептид (ВКП) является пептидом, состоящим из 28 аминокислот, который впервые был выделен из верхней тонкой кишки свиньи (Said and Mutt. 1970. Science 169: 1217-1218). Этот пептид принадлежит к семейству структурносвязанных пептидов с короткой цепью, которое включает гемодермин, секретин, соматостатины и глюкагон. Этот пептид имеет формулу:
Формула 1
HSDAVFTDNYTRLRKQMAVKKYLNSILN. амид
(где однобуквенные аббревиатуры аминокислот можно найти у Zubay, Biochemistry 2d ed., 1988. MacMillan Publishing: New York. p. 33).
Биологические эффекты ВКП опосредованы активацией мембраносвязанных рецепторных пептидов, которые связаны с внутриклеточной циклической сигнальной системой аденозин монофосфата. ВКП регулирует множество разнообразных биологических активностей в тканях и органах. Он модулирует клеточные метаболические активности и регулирует экзокринную и эндокринную секреции. Он также стимулирует расслабление гладкой мышцы и вызывает эффекты расширения сосудов. ВКП также принимает участие в регулировании клеточной пролиферации и выживании в ряде различных клеточных типов, включающих кератиноциты, клетки гладкой мышцы, симпатические нейробласты, гиппокамповые клетки и in vitro NIH 3T3 клетки.
Рецепторы ВКП широко распространены в желудочно-кишечном тракте и встречаются также в различных других типах клеток. Большое количество рецепторов ВКП представлено в опухолевых клетках, например аденокарцином, рака груди, меланом, нейробластом и панкреатических карцином. Фактически, экспрессия участков связывания, имеющих высокое сродство к ВКП (включая белок рецептора ВКП), является маркером для этих опухолевых клеток. Специфическое связывание ВКП с этими клетками может быть использовано в качестве маркера для локализации и идентификации подобных опухолевых клеток in vivo.
Известно, что для радиоотображения пригодно большое число радионуклидов, включая 67Ga, 99mTc (в дальнейшем Тс-99m), 111In, 123I, 125I, 169Yb или 186Re. Для оптимального радиоотображения на людях необходимо принять во внимание ряд факторов. Для того чтобы максимизировать эффективность определения, предпочтителен радионуклид, который излучает гамма-энергию в пределах от 20 до 200 кэВ (килоэлектронвольт). Чтобы минимизировать дозу поглощенной радиации у пациента, период полураспада радионуклида должен быть мал настолько, насколько допускает процедура отображения. Чтобы исследование могло быть выполнено в любое время, необходимо, чтобы источник радионуклида всегда имелся в распоряжении на клиническом участке.
Известны методы радиойодирования аналогов ВКП в тирозиновых остатках в последовательности ВКП (Tyr10 или Tyr22) с использованием 123I или 125I. Эти радиойодированные виды также были использованы для того, чтобы оценить связывание ВКП с рецепторами на опухолевых клетках.
Boissard et al. , 1986, Cancer Res. 46: 4406-4413 описывает paдиойодирование ВКП и связывание с клетками аденокарциномы человеческой толстой кишки.
El Battari et al., 1988, J. Вiol. Chem. 263: 17685-17689 описывает радиойодирование ВКП и связывание с клетками аденокарциномы человеческой толстой кишки.
Shaffer et al., 1987, Peptides 8: 1101-1106 раскрывает радиойодирование ВКП и связывание с клетками карциномы человеческих мелких клеток и немелких клеток.
Svoboda et al. , 1988, Eur. J. Biochem. 176: 707-713 раскрывает радиойодирование ВКП и связывание с трансформированными панкреатическими клетками концевого отдела желез крысы.
Gespach et al. , 1988, Cancer Res. 48, 5079 - 5083 раскрывает радиойодирование ВКП и связывание с человеческими раковыми клетками груди.
Muller et al., 1989, J. Biol. Chem. 264: 3647 - 3650 раскрывает радиойодирование ВКП и связывание с клетками человеческой нейробластомы.
Lee et al., 1990, Peptides 11: 1205-1210 раскрывает радиойодирование ВКП и связывание с клетками карциномы человеческих мелких клеток и немелких клеток.
Park et al., 1990, Cancer Res. 50, 2773-2780 раскрывает радиойодирование ВКП и связывание с человеческими раковыми клетками желудка.
Bellan et al., 1992, Exp. Cell Res. 200: 34-40 раскрывает радиойодирование ВКП и связывание с клетками человеческой меланомы.
Moody et al., 1993, Proc. Natl. Acad. Sci. USA 90: 4345-4349 раскрывает радиойодирование ВКП и связывание с клетками карциномы немелких клеток легких.
Virgolini et al., 1994, Cancer Res. 54, 690-700 раскрывает радиойодирование ВКП и связывание с первичными опухолями и опухолевыми клеточными линиями.
Эти методы используются для того, чтобы сделать возможным определение опухолевых клеток in vivo путем радиоотображения, в особенности радиосцинтиграфией. ВКП является маркером для такого радиоотображения, поскольку большое количество различных опухолевых клеток обладают участками связывания с высоким сродством к ВКП (к пептиду рецептора ВКП). Однако, получение радиойодированных пептидов в промышленных масштабах имеют свои недостатки. 123I дорог и запасы его ограничены. Также одобренные радиойодированные фармацевтические препараты обычно не могут быть приготовлены на клиническом участке.
Tc-99m является предпочтительным радионуклидом, поскольку он испускает гамма-излучение в 140 кэВ, имеет физический период полураспада 6 часов и легкодоступен непосредственно на месте при использовании генератора молибден - 99/технеций - 99m. Другие радионуклиды, использованные в предыдущей области техники, менее выгодны, чем Tc - 99m. Это можно объяснить тем, что физические периоды полураспада этих радионуклидов больше, что приводит к большему объему дозы поглощенной радиации у пациента (например, индия -111). С другой стороны, энергия гамма излучения таких альтернативных радионуклидов значительно ниже (например, у йода - 125) или выше (например, у йода-131), чем у Tc - 99m и вследствие этого не подходит для качественного сцинтиграфического отображения.
Tc - 99m представляет собой переходный металл, который легко образует хелатный комплекс с составляющей металлом. Комплексообразующие составляющие радиометки, способные связать Tc - 99m, могут быть ковалентно связаны с определенными связывающими соединениями, чтобы обеспечить способы мечения подобных определенных связывающих соединений. Это объясняется тем, что обычно наиболее доступная химическая разновидность Тс-99m, пертехнетат (TcO4), не способен связываться непосредственно с большинством определенных связывающих соединений достаточно прочно для того, чтобы быть пригодным в качестве радиофармацевтического препарата. Образование Tc - 99m комплекса с подобными комплексообразующими составляющими радиометки влечет за собой химическое восстановление пертехнетата при использовании хлорида олова в качестве восстанавливающего агента.
Хотя Tc - 99m является предпочтительным радионуклидом для сцинтиграфического радиоотображения, он не использовался широко для мечения пептидов (см. Lamberts. 1991. J. Nucl. Med. 32: 1189-1191). Это объясняется тем, что способы, известные из предыдущей области техники для мечения пептидных молекул большего размера (т.е., размера >10000 дальтонов) Tc-99m не подходят для мечения белков, имеющих размер молекулы менее чем 10000 дальтонов. Следовательно, необходимо метить радиоактивным изотопом большинство пептидов при помощи ковалентного присоединения радионуклидной хелатирующей составляющей к пептиду так, чтобы эта хелатирующая составляющая была включена местоселективно в любой участок пептида, который не будет препятствовать специфическим связывающим свойствам самого пептида.
Способы мечения пептидов Tc-99m раскрыты в US Patent Serial N 5225180 и в US Patent Applications Serial Nos. 07/653.012, 07 /807.062, 07/851.074, 07/871.282, 07/886.752, 07/893.981, 07/902.935, 07/955.466, 07/977.628, 08/019.864, 08/044.825 и 08/073.577, 08/092.355, 08/095.760, 08/210.822, и PCT International Applications PCT/US92/00757, PCT/US92/10716, PCT/US93/02320, PCT/US93/03687, PCT/US93/04794, PCT/US93/05372, PCT/US93/06029, PCT/US93/09387 и PCT/US94/01894, которые таким образом включены здесь ссылкой. Однако ни одна из этих ссылок не раскрывает точно, как получить меченные Tc-99m вазоактивные кишечные пептиды.
В данной области техники известны способы получения комплексов Tc - 99m и ниже приведены примеры для общей ссылки:
Byrne et al., US Patent N 4434151, 4575556 и 4571430 описывает бифункциональные хелатирующие агенты, полученные из гомоцистеин тиолактона.
Fritzberg, US Patent N 4444690 описывает серию технеций-хелатирующих агентов, основанных на 2,3 - бис (меркаптоацетамидо)-пропаноате.
Nosco et al. , US Patent N 4,925,650 описывает Tc-99m хелатирующие комплексы.
Kondo et al. , European Patent Application. Publication N 483704 A1 раскрывает способ получения комплекса Те-99m с меркапто - Gly - Gly - Gly составляющей.
European Patent Application N 84109831.2 описывает бисамидо, бистиол Tc-99m лиганды и их соли в качестве агентов мониторинга почечной функции.
Davi_ son et al., 1981. Inorg. Chem. 20: 1629 -1632 описывает хелатные комплексы оксотехнеция.
Fritzberg et. al., 1982, J. Nucl. Med. 24: 592 - 598 раскрывает Тс-99m хелатирующий агент, основанный на N,N'-бис(меркаптоацетил)-2,3-диаминопропаноате.
Byrne et al. , 1983, J. Nucl. Med. 24: P126 описывает гомоцистинсодержащие Tc - 99m хелатирующие агенты.
Bryson et al. , 1988. Inorg. Chem. 27: 2154-2161 описывает нейтральные комплексы технеция-99, которые неустойчивы к избытку лиганда.
Misra et al., 1989. Tetr. Lett. 30: 1885 -1888 описывает бисаминные бистиольные соединения для пометки радиоактивным изотопом.
В данной области техники известно об использовании хелатирующих агентов для пометки радиоактивным изотопом специфично-связывающих соединений и ниже приведены примеры для общей ссылки:
Gansow et al. , US Patent N 4472509 указывает способы производства и очистки Tc-99m хелат-конъюгированных моноклональных антител.
Stavrianopoulos, US Patent N 4943523 указывает детектируемые молекулы, включающие хелатирующие металлсоставляющие.
Fritzberg et al. , European Patent Application N 86100360.6 описывает дитиольные, диаминные комплексы или комплексы диамидокарбоновых кислот или аминов, пригодные для создания отображающих агентов, меченных технецием.
Albert et al., U. К. Patent Application 8927255.3 раскрывает радиоотображение с использованием производных соматостатина, таких как октреотид, меченный 111In через хелатирующую группу, связанную с терминальной амино-группой.
Albert et al., European Patent Application N WO 91/01144 раскрывает радиоотображение с использованием помеченных радиоактивным изотопом пептидов, имеющих отношение к факторам роста, гормонам, интерферонам и цитокинам и состоящим из точно распознаваемого пептида, ковалентно связанного через амино-группу упомянутого пептида с хелатирующей группой радионуклида.
Fischman et al. , International Patent Application. Publication N WO 93/13317 раскрывает хемотактические пептиды, связанные с хелатирующими составляющими.
Kwekkeboom et al., 1991, J. Nucl. Med. 32: 981 Abstract # 305 относится к аналогам соматостатина, меченным радиоактивным изотопом 111In.
Aibert et al. , 1991, Abstract LM10, 12th American Peptide Symposium: 1991 описывает применения для диэтилен-триаминопентауксусная кислота-производных аналогов соматостатина, меченных 111In.
Cox et al. , 1991, Abstract. 7th International Symposium on Radiopharmacology, p. 16, раскрывает использование помеченных Tc-99m, 131I и 111In аналогов соматостатина для радиолокализации эндокринных опухолей in vivo при помощи сцинтиграфии.
Способы пометки Tc-99m некоторых специфично - связывающих соединений, главным образом больших пептидов, известны в данной области техники и ниже приведены примеры для общей ссылки:
Hnatowich. US Patent N 4668503 описывает пометку пептида радиоактивным изотопом Tc-99m.
Tolman. US Patent N 4732684 описывает конъюгацию молекул - мишеней и фрагментов металлотионеина.
Nicolotti et al., US Patent N 4861869 описывают бифункциональные связывающие агенты, пригодные для образования конъюгатов с такими биологическими молекулами, как антитела.
Fritzberg et al., US Patent N 4965392 описывают различные хелатирующие агенты, основанные на S-защищенном меркаптоацетилглицилглицине, для пометки пептидов.
Schochat et al., US Patent N 5061641 раскрывает непосредственное мечение радиоактивным изотопом пептидов, содержащих по крайней мере одну "висячую" сульфогидрильную группу.
Fritzberg et al., US Patent N 5091514 описывают различные хелатирующие агенты, основанные на S-защищенном меркаптоацетилглицилглицине, для пометки пептидов.
Gustavson et al. , US Patent N 5112953 раскрывает Tc-99m хелатирующие агенты для мечения пептидов радиоактивным изотопом.
Kasina et al. , US Patent N 5175257 описывает различные комбинации молекул - мишеней и Tc-99m хелатирующих групп.
Dean et al., US Patent N 5180816 раскрывает способ мечения пептидов радиоактивным изотопом Tc-99m через бифункциональный хелатирующий агент.
Sundrehagen, International Patent Application. Publication N WO 85/03231 раскрывает мечение пептидов Tc-99m.
Reno and Bottino, European Patent Application 87300426.1 раскрывает способ мечения молекул антител радиоактивным изотопом Тс-99m.
Bremer et al. , European Patent Application N 87118142.6 раскрывает способ мечения молекул антител радиоактивным изотопом Tc-99m.
Pak et al., European Patent Application N WO 88/07382 pacкрывает способ мечения молекул антител радиоактивным изотопом Tc-99m.
Goedemans et al., PCT Application N WO 89/07456 описывают мечение пептидов радиоактивным изотопом с использованием циклических тиоловых соединений, в частности, 2 - иминотиолана и производных.
Dean et al., International Patent Application. Publication N WO 89/12625 указывают бифункциональные связывающие агенты для мечения пептидов Tc - 99m.
Schoemaker et al. , International Patent Application. Publication N WO 90/06323 раскрывают химеровые пептиды, включающие металлсвязывающую область.
Thornback et al. , EPC Application N 90402206.8 описывают получение и использование меченных радиоактивным изотопом пептидов или пептидов с использованием тиол - содержащих соединений, в частности, 2-иминотиолана.
Gustavson et al. , International Patent Application. Publication N WO 91/09876 раскрывают Tc-99m хелатирующие агенты для мечения пептидов радиоактивным изотопом.
Rhodes, 1974, Sem. Nucl. Med. 4: 281 -293 указывают, как метить технецием-99m человеческий сывороточный альбумин.
Khaw et al., 1982, J. Nucl. Med. 23: 1011-1019 раскрывают способы мечения биологически активных макромолекул Tc-99m.
Schwartz et al. , 1991, Bioconjugate Chem. 2: 333 описывают способ мечения пептидов радиоактивным изотопом Tc-99m с использованием гидразиноникотинамидной группы.
Попытки мечения пептидов радиоактивными изотопами сообщены в предыдущей области техники.
Ege et al., US Patent N 4832940 указывают на меченные радиоактивным изотопом пептиды для отображения локализованных Т-лимфоцитов.
Morgan et al., US Patent N 4986979 раскрывают способы отображения участков воспаления.
Flanagan et al., US Patent N 5248764 описывают конъюгаты между меченной радиоактивным изотопом хелатирующей составляющей и предсердными натиуретными фактор - производными пептидами.
Ranby et al., 1988, PCT/US88/02276 раскрывают способ определения отложений фибрина у животных, включающий ковалентное связывание меченного радиоактивным изотопом соединения с фибрином.
Lees et al., 1989, PCT/US89/01854 указывают меченные радиоактивным изотопом пептиды для артериального отображения.
Morgan et al. , International Patent Application. Publication N WO 90/10463 раскрывают способы отображения участков воспаления.
Flanagan et al. , European Patent Application N 90306428.5 раскрывают мечения фрагментов синтетических пептидов радиоактивным изотопом Tc-99m через ряд органических хелатирующих молекул.
Stuttle, РСТ Application N WO 90/15818 предлагает мечение радиоактивным изотопом Tc-99m RGD-содержащих олигопептидов.
Rodwell et al., 1991, РСТ/US91/03116 раскрывают конъюгаты "единиц молекулярного узнавания" и "доменов эффектора".
Cox. International Patent Application N PCT/US92/04559 раскрывает меченные радиоактивным изотопом производные соматостатина, содержащие два цистеиновых остатка.
Rhodes et al. , International Patent Application. Publication N WO 93/12819 указывают пептиды, содержащие металлические ион-связывающие домены.
Lyle et al., International Patent Application. Publication N WO 93/15770 раскрывают Tc-99m хелатирующие агенты и пептиды, меченные Tc-99m.
Coughlin et al. , International Patent Application. Publication N WO 93/21151 раскрывают бифункциональные хелатирующие агенты, содержащие группы тиомочевины, для мечения радиоактивным изотопом молекул-мишеней.
Knight et al., 1990, 37th Annual Meeting of the Society of Nuclear Medicine, Abstract N 209, заявляет отображение тромбов с использованием пептидов, меченных Tc - 99m.
Babich et al., 1993, J. Nucl. Med. 34: 1964-1974 описывают меченные Tc - 99m пептиды, включающие производные гидразиноникотинамида.
Меченные радиоактивным изотопом производные пептидов, связывающих рецептор ВКБ и их фрагменты, аналоги и миметики можно также использовать терапевтически. Для этих целей наиболее преимущественно использование цитотоксичных радиоизотопов рения-186 и рения-188.
Таким образом, существует необходимость в синтетических пептидах, связывающих ВКБ рецептор, производство которых менее трудоемкое, простое, их производных, аналогов и миметиков, которые могут быть помечены радиоактивным изотопом Tc - 99m для использования в качестве сцинтиграфических агентов и которые могут быть помечены радиоактивным изотопом рения -186 или рения -188 для использования в качестве радиотерапевтических агентов. Настоящее изобретение раскрывает низкомолекулярные синтетические белки, связывающие рецептор ВКБ, их производные, аналоги и миметики, содержащие хелатные группы для хелатирования Tc-99m, Re-186 или Re-188 и их Tc-99m-, Re-186- и Re-188-меченные производные.
ОПИСАНИЕ ИЗОБРЕТЕНИЯ
Настоящее изобретение обеспечивает рентгенофармацевтические препараты, которые представляют собой рецептор связывающие вазо-активные кишечновазоактивные кишечные пептиды, меченные Tc-99m, Re-86 или Re-188, для рентгенотерапевтического использования и рентгенодиагностического использования, в частности, использования для сцинтиграфического отображения. Настоящее изобретение обеспечивает также рецептор-связывающие вазоактивные кишечные пептидные реагенты, состоящие из вазоактивных кишечных пептидов, связывающих рецептор, их производных, аналогов и миметиков, где подобные соединения ковалентно связаны с хелатирующей составляющей. Настоящее изобретение обеспечивает также рецептор-связывающие вазоактивные кишечные пептиды, рецептор-связывающие вазоактивные кишечные пептидные реагенты и меченные радиоактивным изотопом связывающие вазоактивные кишечные пептидные реагенты, которые являются сцинтиграфическими отображающими агентами, рентгенодиагностическими агентами и рентгенотерапевтическими агентами.
Сцинтиграфические отображающие агенты настоящего изобретения включают рецептор связывающие вазоактивные кишечные пептидные реагенты, меченные радиоактивным изотопом технеция-99m. Рентгенографические агенты настоящего изобретения включают рецептор-связывающие вазоактивные кишечные пептидные реагенты, меченные радиоактивным изотопом рения-186 или рения-188. Также обеспечиваются способы получения и использования таких рецептор-связывающих вазоактивных кишечных пептидных реагентов и их меченных радиоактивным изотопом воплощений.
Настоящее изобретение относится к реагенту для получения рентгенофармацевтического препарата, где реагент является синтетическим рецептор-связывающим вазоактивным кишечным пептидом (определяемым как любое синтетическое соединение, включающее в себя ВКП, его фрагменты, производные, аналоги и миметики, которые связываются с рецептором ВКП), который ковалентно связан с хелатирующей составляющей, способной хелатировать радиоактивную метку технеция или рения. Хелатирующая составляющая включается в реагент во время его синтеза. В дополнение к этому, меченные технецием или рением рентгенофармацевтические препараты настоящего изобретения обладают сродством к связыванию рецептора ВКП, которое не меньше, чем около одной десятой сродства радиойодированного природного ВПК. В предпочтительном варианте воплощения, настоящее изобретение обеспечивает сцинтиграфические отображающие агенты, включающие любой реагент этого изобретения, меченый Тс-99m. В других предпочтительных вариантах воплощения, настоящее изобретение обеспечивает рентгенотерапевтические агенты, включающие любой реагент этого изобретения, меченый цитотоксичным радиоактивным изотопом, выбранным из группы, состоящей из рения-186 или рения-188. Комплексы этого реагента и радиоактивных меток, являющихся Tc-99m, Re-186 или Re-188, образуются при взаимодействии любого реагента изобретения с радиоактивной меткой в присутствии восстанавливающего агента, например, иона олова. Также обеспечиваются комплексы Tc-99m, Re-186 или Re-188 с реагентами настоящего изобретения, образующиеся при обмене лигандов меченного радиоактивным изотопом комплекса до восстановления.
Таким образом, настоящее изобретение обеспечивает также сцинтиграфические отображающие агенты, включающие рецептор-связывающие вазоактивные кишечные пептидные реагенты изобретения, где хелатирующая составляющая образует стабильный комплекс с Tc-99m.
Настоящее изобретение относится также к фармацевтическим композициям, включающим меченные радиоактивным изотопом рецептор-связывающие вазоактивные кишечные пептиды настоящего изобретения в фармацевтически приемлемом носителе.
Другой аспект настоящего изобретения обеспечивает реагенты для получения рентгенотерапевтических и рентгенодиагностических препаратов, включающих предпочтительно сцинтиграфические отображающие агенты. Каждый такой реагент состоит из соединения, являющегося вазоактивным кишечным пептидом, производным, аналогом или миметиком, ковалентно связанным с хелатирующей составляющей.
Реагенты настоящего изобретения, использующие для получения меченных радиоактивным изотопом агентов, являются реагенты, каждый из которых состоит из рецептор-связывающего вазоактивного кишечного пептида, как описано выше, который ковалентно связан с хелатирующей составляющей, имеющей формулу:
C (pgp)s - (aa) - C(pgp)s,
где (pgp)s является водородом или тиолзащитной группой и (aa) является любой а- или b-аминокислотой, не содержащей тиольной группы. Предпочтительно этой аминокислотой является глицин. В другом предпочтительном варианте воплощения этот агент является сцинтиграфическим отображающим агентом. В другом предпочтительном варианте воплощения этот агент является рентгенотерапевтическим агентом.
Во втором варианте настоящее изобретение относится к рецептор-связывающим вазоактивным кишечным пептидным реагентам, способным быть меченными радиоактивным изотопом для того, чтобы образовывать рентгенодиагностические и рентгенотерапевтические агенты, каждый из которых включает вазоактивный кишечный пептид, ковалентно связанный с хелатирующей группой, включающей составляющую, содержащую один тиол, имеющий формулу:
A-CZ(B)-{C(RaRb)}n-X,
где A является водородом, HOOC, H2NOC, (пептид) - NHOC, (пептид) - OOC, R2cNOC или Rd; B является H, SH или - NHRc, - N (Rc) - (пептид) или Rd; Z является H или Rd; X является SH или - NHRc, - N (Rc ) -(пептид) или Rd; Ra, Rb, Rc и Rd являются независимо водородами или прямыми или разветвленными или циклическими низшими алкилами; n равен 0, 1 или 2; Rc является C1 - C4 алкилом, аминокислотой или пептидом, включающим от 2 до 10 аминокислот; и: (1) где B является - NHRc или - N (Rc) -(пептид), X является SH и n равен 1 или 2; (2) где X является - NHRc или - N(Rc) - (пептид), B является SH и n равен 1 или 2; (3) где B является H или Rd; A является HOOC, H2NOC, (пептид) - NHOC или (пептид) - OOC, X является SH и n равен 0 или 1; (4) где A является H или Rd, тогда как B является SH, X является - NHRc или - N(Rc) - (пептид) и где X является SH, В является - NHRc или - N(Rc) - (пептид) и n равен 1 или 2; (5) где X является H или Rd, A является HOOC, H2NOC, (пептид) - NHOC или (пептид) - OOC и B является SH; (6) где Z является метилом, X является метилом, A является HOOC, H2NOC, (пептид) - NHOC или (пептид) - OOC и B является SH и n равен 0. В предпочтительном варианте воплощения, этот агент является сцинтиграфическим отображающим агентом. В следующем другом предпочтительном варианте воплощения, этот агент является рентгенотерапевтическим агентом.
Предпочтительные варианты воплощения этой хелатирующей составляющей имеют следующую химическую формулу:
R1 - CO - (аминокислота)1 - (аминокислота)2-Z где (аминокислота)1 и (аминокислота)2 каждая является независимо любой первичной а- или b-аминокислотой, не содержащей тиольной группы, Z является тиолсодержащей составляющей, представляющей собой цистеин, гомоцистеин, изоцистеин, пеницилламин, 2 - меркаптоэтиламин или 3 - меркаптопропиламин, и R1 является низшим (C1 - C4) алкилом, аминокислотой или пептидом, включающим от 2 до 10 аминокислот; или
Y -(аминокислота)2 - (аминокислота)1 -NHR2,
где Y является тиолсодержащей составляющей, представляющей собой цистеин, гомоцистеин, изоцистеин, пеницилламин, 2 - меркапто-этиламин или 3 - меркаптопропиламин, (аминокислота)1 и (аминокислота)2 каждая является независимо любой первичной а- или b-аминокислотой, не содержащей тиольной группы, и R1 является водородом или низшим (C1 - C4) алкилом, аминокислотой или пептидом, включающим от 2 до 10 аминокислот. Когда Y является цистеином, гомоцистеином, изоцистеином или пеницилламином, аминогруппа упомянутой составляющей ковалентно связана с H-, аминокислотой или пептидом содержащим от 2 до 10 аминокислот.
В частных вариантах воплощения этого аспекта изобретения хелатирующая составляющая имеет следующую формулу:
IIа - (аминокислота)1 - (аминокислота)2 -A- CZ(В)-{С(R1R2)}n - X},
IIб - A- CZ(В)-{С(R1R2)}n - X}- (аминокислота)1 - (аминокислота)2,
IIв - (первичная α,β- или β,γ-диаминокислота) - (аминокислота)1 - A - CZ(B)-{С(R1R2)}n - X}, или
IIг - A- CZ(В)-{С (R1К2)}n - X}- (аминокислота)1 - (первичная α,β- или β,γ- диаминокислота) где (аминокислота)1 и (аминокислота)2 каждая является независимо любой существующей в природе, модифицированной, замещенной или измененной а- или b-аминокислотой, не содержащей тиольной группы; A является H, HOOC, H2NOC, (аминокислота или пептид) - NHOC или (аминокислота или пептид) - OOC или R4; B является H, SH или - NHR3 или - N (R3) -(аминокислота или пептид) или R4; Z является H или R4; X является SH или -NHR3, -N(R3)-(аминокислота или пептид) или R4; R1, R2, R3 и R4 являются независимо водородами или прямыми или разветвленными ациклическими или циклическими низшими алкилами; n является целым числом, равным либо 0, 1 либо 2; (пептид) представляет собой пептид из от 2 до 10 аминокислот; и: (1) где В является -NHR3 или - N (R3) -(аминокислота или пептид), X является SH и n равен 1 или 2; (2) где X является -NHR3 или - N (R3) -(аминокислота или пептид), B является SH и n равен 1 или 2; (3) где B является H или R4, A является HOOC, H2NOC, (аминокислота или пептид) -NHOC или (аминокислота или пептид) - OOC, X является SH и n равен 1 или 2; (4) где A является H или R4, тогда B является SH, X является - NHR3 или - N (R3) -(аминокислота или пептид), и где X является SH, B является - NHR3 или - N (R3) - (аминокислота или пептид) и n равен 1 или 2; (5) где X является H или R4, A является HOOC, H2NOC, (аминокислота или пептид) - NHOC или (аминокислота или пептид) - OOC и B является SH; (6) где Z является метилом, X является метилом, A является HOOC, H2NOC, (аминокислота или пептид) - NHOC или (аминокислота или пептид) - OOC и В является SH и n равен 0.
Дополнительные предпочтительные варианты воплощения включают хелатирующие составляющие, имеющие формулу: - Gly - Gly - Cys -, Cys - Gly - Gly, -Gly- Gly -Cys-, -( ε -Lys)- Gly - Cys-, ( δ - Orn) - Gly- Cys-, -( γ -Dab)-Gly-Cys-, -(β -Dap)- Lys- Cys- и -( β -Dap)- Gly - Cys -. (Нужно понимать, что в данных формулах ε - Lys представляет собой остаток лизина, в котором ε - аминогруппа, а не типичная α - аминогруппа, ковалентно связана с карбоксильной группой соседней аминокислоты с образованием пептидной связи; δ - Orn представляет собой остаток орнитина, в котором δ - аминогруппа, а не типичная α - аминогруппа, ковалентно связана с карбоксильной группой соседней аминокислоты с образованием пептидной связи; γ - Dab представляет собой остаток 2,4 - диаминобутановой кислоты, в которой γ - аминогруппа ковалентно связана с карбоксильной группой соседней аминокислоты с образованием пептидной связи; и β - Dap представляет собой остаток 1, 3 - диаминопропионовой кислоты, в которой β - аминогруппа ковалентно связана с карбоксильной группой соседней аминокислоты с образованием пептидной связи).
Другой вариант осуществления изобретения обеспечивает рецептор-связывающие вазоактивные кишечные пептидные реагенты, меченные радиоактивным изотопом, для отображения участков в теле млекопитающего или для рентгенотерапевтических целей, каждый из которых включает вазоактивный кишечный пептид, который ковалентно связан с хелатирующей составляющей, представляющей собой бисамино - бистиольную хелатирующую составляющую. Эта бисамино - бистиольная хелатирующая составляющая имеет формулу:

где каждый R может быть независимо H, CH3 или C2H5; каждая (pgp)s может быть независимо тиольной защитной группой или H; m, n, и p равны независимо 2 или 3; A является линейным или циклическим низшим алкилом, арилом, гетероциклилом, их комбинациями или замещенными производными; а X является пептидом; или

где каждый R может быть независимо H, CH3 или C2H5, m, n, и p равны независимо 2 или 3; A является линейным или циклическим низшим алкилом, арилом, гетероциклилом, их комбинациями или замещенными производными; V является H или CO - пептидом; R' является H или пептидом, при условии, что когда V является H, R' является пептидом, а когда R' является H, V является пептидом. Для целей настоящего изобретения хелатирующие составляющие, имеющие эти формулы, будут называться "ВАТ" составляющими. В предпочтительном варианте воплощения агент является сцинтиграфическим отображающим агентом. В другом следующем варианте воплощения агент является рентгенотерапевтическим агентом.
Это изобретение также обеспечивает рентгенофармацевтические агенты и реагенты для получения таких рентгенофармацевтических препаратов, включающих рецептор-связывающий вазоактивный кишечный пептид, ковалентно связанный с хелатирующей составляющей, выбранной из группы, состоящей из:
(i) группы, имеющей формулу:

(ii) группы, имеющей формулу:

где n, m, p является каждое целым числом и равно независимо 0 или 1; каждый R' является независимо H, низшим алкилом, C2-C4 гидроксиалкилом, или C2 - C4 алкоксиалкилом, и каждый R является независимо H или R'', где R'' представляет собой замещенный или незамещенный низший алкил или фенил, не содержащий тиольную группу, и один R или R' является L, где L представляет собой двухвалентную связывающую составляющую, связывающую хелатируемый металл с целевой составляющей и где в том случае, когда один R' является L, NR'2 является любым амином.
В предпочтительных вариантах осуществления L является C1-C6 линейной, разветвленной цепью или циклической алкильной группой, эфиром карбоновой кислоты, амидом карбоновой кислоты, сульфонамидом, простым эфиром, тиоэфиром, амином, алкеном, алкином, 1,2-1,3- или 1,4 - связанным, при необходимости бензольным кольцом, или аминокислотой, или пептидом из от 2 до около 10 аминокислот, или их комбинациями.
В предпочтительных вариантах осуществления R'' является C1-C6 линейной, разветвленной или циклической алкильной группой; - CqOCr -, - CqNHCr - или - CqSCr - группой, где q и r являются целыми числами независимо от 1 до 5, где сумма q + r не превышает 6; (C1 - C6) алкил X, где X является гидроксильной группой, замещенным амином, гуанидином, амидином, замещенной тиольной группой, или карбоновой кислотой, сложным эфиром, фосфатной или сульфатной группой; фенильной группой или фенильной группой, замещенной галогеном, гидроксилом, замещенным амином, гуанидином, амидином, замещенной тиольной группой, сложным эфиром, фосфатной или сульфатной группой; индольной группой; C1 - C6 гетероциклической группой, содержащей от 1 до 3 атомов азота, кислорода или серы, или их комбинаций.
Предпочтительные хелатирующие составляющие этого изобретения включают хелатирующие агенты, имеющие формулу:

где R1 и R2 являются каждый независимо H, низшим алкилом, C2 - C4 гидроксиалкилом, или C2 - C4 алкоксиалкилом, R3, R4, R5 и R6 представляют собой независимо H, замещенный или незамещенный низший алкил или фенил, не содержащий тиольную группу; R7 и R8 представляют собой независимо H, низший алкил, низший гидроксиалкил или низший алкоксиалкил; L является двухвалентной связывающей группой и Z является вазоактивным кишечным пептидом.
Дополнительные предпочтительные хелаторы металла включают хелаторы формулы:

где R1 и R2 являются каждый независимо H, низшим алкилом, C2 - C4 гидроксиалкилом, или C2 - C4 алкоксиалкилом, R3, R4, R5 и R6 представляют собой независимо H, замещенный или незамещенный низший алкил или фенил, не содержащий тиольную группу и один из R3, R4, R5 и R6 является Z -L- HN(CH2)n, где L является двухвалентной связывающей группой, Z является целевой составляющей и n - целое число от 1 до 6; и R7 и R8 являются каждый независимо H, низшим алкилом, низшим гидроксиалкилом; и X является аминогруппой, замещенной аминогруппой или -NR1-Y, где Y- аминокислота, амид аминокислоты, или пептид, включающий от 2 до 10 аминокислот.
Более предпочтительные хелаторы металла изобретения включают хелаторы, имеющие формулу:

где R1 и R2 являются каждый независимо H, низшим алкилом, низшим гидроксиалкилом или низшим алкенилалкилом; R3 и R4 являются независимо H, замещенным или незамещенным низшим алкилом или фенилом, не содержащим тиольной группы, n является целым числом от 1 до 6; L является двухвалентной связывающей группой, и Z является вазоактивной кишечной пептидной составляющей.
Дополнительные более предпочтительные хелатирующие составляющие включают хелаторы, имеющие формулу:

где L является двухвалентной связывающей группой, и Z является вазоактивной кишечной пептидной составляющей.
Наиболее предпочтительные хелатирующие составляющие изобретения включают хелаторы, имеющие формулы:
(аминокислота)1 - (аминокислота)2 - цистеин -,
(аминокислота)1 - (аминокислота)2 - изоцистеин -,
(аминокислота)1 - (аминокислота)2 - гомоцистеин -,
(аминокислота)1 - (аминокислота)2 - пеницилламин -,
(аминокислота)1 - (аминокислота)2 - 2 - меркаптоэтиламин -,
(аминокислота)1 - (аминокислота)2 - 2 - мекаптопропиламин -,
(аминокислота)1 - (аминокислота)2 - 2 - меркапто - 2 - метилпропиламин-,
(аминокислота)1 - (аминокислота)2 - 3 - меркаптопропиламин -,
где (аминокислота) является первичной α- или β- аминокислотой, не содержащей тиольной группы и где хелатор связан либо с целевой составляющей, либо со связывающей группой через ковалентную связь между терминальной карбоксильной группой хелатора или боковой цепи одной из аминокислотных групп.
Наиболее предпочтительные хелаторы включают также хелаторы вышеупомянутой формулы, где (аминокислота)1 представляет собой либо α,γ-, , либо β,γ-аминокислоту, где α- или β-аминогруппы являются свободными аминами a α,γ-, или β,γ-аминокислоты ковалентно связаны через γ-аминогруппу.
Другие наиболее предпочтительные хелаторы включают выбранные из группы, состоящей из:
- цистеин - (аминокислота) -( α,β- или β,γ-диаминокислоты),
- изоцистеин - (аминокислота) - ( α,β- или β,γ-диаминокислоты),
- гомоцистеин - (аминокислота) - ( α,β- или β,γ-диаминокислоты),
- пеницилламин - (аминокислота) -( α,β- или β,γ-диаминокислоты),
-2- меркаптоуксусная кислота - (аминокислота) -( или β,γ-диаминокислоты),
-2- или 3-меркаптопропионовая кислота- (аминокислота)-( α,β- или ( β,γ-диаминокислоты),
-2- меркапто - 2 - метилпропионовая кислота - (аминокислота) - ( α,β- ) или β,γ-диаминокислоты),
где (аминокислота) является первичной α- или β-аминокислотой, не содержащей тиольной группы и где хелатор связан либо с целевой составляющей, либо со связывающей группой через ковалентную связь с терминальной аминогруппой хелатора или боковой цепи на одной из аминокислотных групп.
Особенно предпочтительные хелаторы металла выбирают из группы, состоящей из: - Gly - Gly - Cys -, Arg - Gly - Cys, -( ε - Lys) - Gly - Cys -, ( δ - Orn) - Gly - Cys-, - (γ - Dab) - Gly - Cys -, -( β - Dap) - Lys- Cys- и -( β -Dap) - Gly - Cys-. (Нужно понимать, что в данных формулах ε - Lys представляет собой остаток лизина, в котором ε - аминогруппа, а не типичная α - аминогруппа, ковалентно связана с карбоксильной группой соседней аминокислоты с образованием пептидной связи; δ - Orn представляет собой остаток орнитина, в котором δ - аминогруппа, а не типичная α - аминогруппа, ковалентно связана с карбоксильной группой соседней аминокислоты с образованием пептидной связи; γ - Dab представляет собой остаток 2,4 - диаминобутановой кислоты, в которой γ - аминогруппа ковалентно связана с карбоксильной группой соседней аминокислоты с образованием пептидной связи; и β - Dap представляет собой остаток 1,3-диаминопропионовой кислоты, в которой β - аминогруппа ковалентно связана с карбоксильной группой соседней аминокислоты с образованием пептидной связи).
Примером предпочтительных хелатирующих составляющих описанной выше структуры типа (III) является хелатор Gly - Gly - Cys -, образующий хелатирующую составляющую, имеющую формулу:

Хелатирующие лиганды, имеющие структуру типа VII образуют комплексы оксотехнеция, имеющие структуру:

Примером более предпочтительных хелатирующих составляющих, имеющих структуру типа V, как показано выше, является Lys -( ω - пептид) - Gly - Cys амид, который образует хелатирующую составляющую структуры:

Хелатирующие лиганды, имеющие структуру типа IX образуют комплексы оксотехнеция, имеющие структуру:

Примером реагента для получения рентгенофармацевтического агента, как это обеспечено в изобретении, который включает хелатирующую составляющую, имеющую структуру типа II, приведенную выше, является (целевая составляющая) -Cys - Gly - α,β- диаминопропионамид, который образует хелатирующую составляющую структуры:

Рентгенодиагностические агенты, имеющие структуру типа XI, образуют комплексы оксотехнеция, имеющие структуру:

В предпочтительных вариантах осуществления изобретения, хелатирующие составляющие ковалентно присоединены к рецептор-связывающим вазоактивным кишечным пептидам, а не к аминогруппам, содержащимся в пептиде. Как здесь описано, имеются особые преимущества для включения хелатирующих составляющих в пептид во время синтеза или включения связывающей составляющей для хелатирующей составляющей в пептид во время химического синтеза. В вазоактивных кишечных пептидах аминогруппы в боковых цепях остатков лизина находятся в разных местах и поэтому не допускают выгодного сайт - специфичного присоединения к хелатирующей составляющей. В частности, в качестве уникальных участков присоединения хелатирующих агентов к рецептор связывающим вазоактивным кишечным пептидам предпочтительны тиольные группы.
Это изобретение также обеспечивает способы получения пептидных реагентов изобретения путем химического синтеза in vitro. В предпочтительном варианте воплощения рецептор связывающие вазоактивные кишечные пептиды синтезируют твердофазным пептидным синтезом.
Это изобретение обеспечивает реагенты для получения меченого вазоактивного кишечного рецептор-связывающего агента, включающего рецептор связывающие вазоактивные кишечные пептиды изобретения, ковалентно связанные с хелатирующей составляющей. В предпочтительном варианте воплощения, реагент мечен радиоактивным изотопом Tc - 99m. В другом предпочтительном варианте воплощения, реагент мечен радиоактивным изотопом Re-186 или Re-188.
Это изобретение также включает агенты, являющиеся комплексами рецептор-связывающих вазоактивных кишечных пептидных реагентов изобретения с радиоактивным изотопом, а также способы мечения радиоактивным изотопом пептидных реагентов изобретения. Например, сцинтиграфические отображающие реагенты, обеспеченные изобретением, включают меченные Tc-99m комплексы, которые образуются при взаимодействии вазоактивных кишечных пептидных реагентов изобретения с Tc-99m в присутствии восстанавливающего агента. Предпочтительные восстанавливающие агенты включают дитионит-ион, ионы олова и железа, но не ограничиваются ими. Такие Tc-99m комплексы изобретения образуются также при мечении вазоактивных кишечных пептидных реагентов изобретения Tc-99m путем обмена лигандов предварительно восстановленного комплекса Tc-99m.
Изобретение обеспечивает также наборы для получения меченых рецептор-связывающих вазоактивных кишечных пептидов из вазоактивных кишечных пептидных реагентов изобретения. Наборы для мечения радиоактивным изотопом пептидных реагентов изобретения включают в себя герметичный сосуд, содержащий заранее определенное количество пептидного реагента изобретения и достаточное количество восстанавливающего агента для мечения реагента. Предпочтительным набором является набор для мечения пептидных реагентов изобретения Tc-99m. Также обеспечено оборудование для получения рентгенотерапевтических агентов, где предпочтительными радиоактивными изотопами являются рений-186 и рений-188.
Изобретение обеспечивает способы диагностического и терапевтического использования меченых вазоактивных кишечных рецептор-связывающих пептидных реагентов изобретения. В одном варианте осуществления изобретения раскрыто применение сцинтиграфических отображающих агентов, являющихся Tc-99m меченными пептидными реагентами, для отображения участков в теле млекопитающего, получая при этом гамма сцинтиграфические изображения in vivo. Эти способы включают введение эффективного диагностического количества меченых пептидных реагентов изобретения и определения гамма излечения, испускаемого радиоактивной меткой, локализованной на участке внутри тела млекопитающего.
Изобретение также обеспечивает способы облегчения связанных с ВКП заболеваний у животных, предпочтительно у людей, включающие введение терапевтически эффективного количества меченых ВКП рецептор-связывающих пептидных реагентов изобретения животному. В предпочтительных вариантах воплощения, реагенты мечены радиоактивным изотопом 186Re или 188Re.
Изобретение обеспечивает также ВКП рецептор-связывающие пептиды, ковалентно связанные с металл-связывающими составляющими, которые образуют комплексы с магнитными, парамагнитными, супермагнитными или суперпарамагнитными атомами, ионами или частицами металла, и способы использования таких комплексов для магнитно-основанного определения локализации подобных рецептор-связывающих вазоактивных кишечных пептидных комплексов в опухоли или других участках ткани in vivo.
Рецептор-связывающие вазоактивные кишечные пептиды и рецептор-связывающие вазоактивные кишечные пептидные реагенты изобретения могут включать в себя также поливалентную связывающую составляющую. Поливалентные связывающие составляющие изобретения включают по крайней мере две идентичные связывающие функциональные группы, которые способны ковалентно связываться с вазоактивными кишечными пептидами или хелатирующими составляющими, или тем, и другим. Предпочтительными связывающими функциональными группами являются первичные или вторичные аминные, гидроксильные группы, карбоксильные группы кислот, или тиольные реакционные группы. В предпочтительных вариантах воплощения, поливалентные связывающие составляющие включают бис-сукцинимидилметиловый эфир (BSME), 4-(2,2-диметилацетил) бензойную кислоту (DMBA), N-{2-N',N'- бис (2-сукцинимидо-этил)-амино-этил)} -N6, N9-бис(2-метил-2- меркаптопропил)- 6,9-диазанонанамид (ВАТ - BS), трис(сукцинимидилэтил) амин (TSEA), бис(сукцинимидогексан) (BSH), 4-(O-CH2CO-Gly-Gly-Cys.амид)-2-метилпропиофенон (ЕТАС), трис(ацетамидоэтил)амин, бис-ацетами-дометиловый эфир, бис-ацетамидоэтиловый эфир, α,ε-бис-ацетил- лизин, лизин и 1,8-бис-ацетамидо-3,6-диокса-октан, или их производные.
Особые предпочтительные варианты осуществления настоящего изобретения будут очевидны из последующего более детального описания некоторых предпочтительных вариантов воплощения и формулы изобретения.
ПОДРОБНОЕ ОПИСАНИЕ ИЗОБРЕТЕНИЯ
Настоящее изобретение относится к рецептор-связывающим вазоактивным кишечным пептидам и их фрагментам, производным, аналогам и миметикам, которые используют в качестве реагентов для получения рецептор-связывающих вазоактивных кишечных пептидных рентгенофармацевтических агентов для диагностики и терапии.
Примерами этих рецептор-связывающих вазоактивных кишечных пептидов, раскрытыми в изобретении, являются рецептор - связывающие вазоактивные кишечные пептидные реагенты, где рецептор-связывающие вазоактивные кишечные пептиды, их фрагменты, производные, аналоги и миметики ковалентно связаны с хелатирующей составляющей. Такие рецептор - связывающие вазоактивные кишечные пептидные реагенты способны быть мечены радиоактивным изотопом с образованием рентгенодиагностических и рентгенотерапевтических агентов. Одним примером рентгенодиагностического применения с использованием меченых агентов изобретения является сцинтиграфическое отображение, где можно определить локализацию и степень опухолей, несущих ВКП-рецептор. Рецептор-связывающие вазоактивные кишечные пептидные реагенты изобретения преимущественно помечают для рентгенотерапевтических использований такими цитотоксичными радиоактивными изотопами, как рений-186 или рений-188.
Tермин сцинтиграфический отображающий агент, как он используется здесь, означает, что он включает в себя меченный радиоактивным изотопом агент, который можно определить методом измерения радиоактивности (включая, но не ограничиваясь гамма-камерой или зондом сцинтилляционного детектора).
С другой стороны, рентгенотерапевтические реагенты изобретения преимущественно мечены рением-86 или рением-88, и используются при лечении связанных с ВКП болезней или прочих заболеваний у животных, предпочтительно, у людей, включая, но не ограничиваясь кишечноректального рака и других заболеваний, характеризующихся ростом злокачественных и доброкачественных опухолей, которые способны связывать ВКП или аналогами ВКП через экспрессию рецепторов ВКП на поверхности клеток, содержащих такие опухоли.
Под термином "связывающее сродство рецептора ВКП" имеется в виду связывающее сродство, измеренное любым известным способом, включая, inter alia, способы, по которым связывающее сродство измеряют по константе диссоциации, константе ингибирования или величине IC50. Под термином "имеет сродство в размере по крайней мере одной десятой от сродства радиойодированного ВКП" имеется в виду, что это сродство не меньше, чем в десять раз меньше сродства радиойодированного ВКП, или что константа ингибирования (Ki) или IC50 не больше аналогичных величин радиойодированного ВКП, чем в десять раз.
В хелатирующих составляющих и рецептор-связывающих вазоактивных кишечных пептидах, связанных с такими составляющими, которые содержат тиолы, ковалентно связанные с тиолзащитными группами {(pgp)s}, обеспеченными изобретением, тиольные защитные группы могут быть одинаковыми или разными и могут быть, но не ограничиваясь, следующими:
-CH2 - арил (арил является фенилом или алкил - или алкоксизамещенным фенилом);
-CH2 - (арил)2, (арил является фенилом или алкил- или алкоксизамещенным фенилом);
-CH2 - (арил)3, (арил является фенилом или алкил - или алкоксизамещенным фенилом);
-CH2 - (4 - метоксифенил);
-CH-(4- пиридил) (фенил)2;
-C(CH3)3;
-9-фенилфлуоренил;
-CH2NHCOR (R является незамещенным или замещенным алкилом или арилом);
-CH2-NHCOOR (R является незамещенным или замещенным алки лом или арилом);
-CONHR (R является незамещенным или замещенным алкилом или арилом);
-CH2-S-CH2- фенил
Предпочтительные защитные группы имеют формулу CH2NHCOR, где R является низшим алкилом, имеющим от 1 до 8 атомов углерода, фенилом, или фенилом, замещенным низшим алкилом, гидроксилом, низшим алкоксилом, карбоксилом, или низшим алкоксикарбонилом. Наиболее предпочтительной защитной группой является ацетамидометильная группа.
Для целей настоящего изобретения, термин "рецептор-связывающий вазоактивный кишечный пептид(ы)" означает, что он включает в себя существующие в природе ВКП, их фрагменты, аналоги, производные и миметики, которые специфично связываются с рецепторами ВКП, выраженными в большом числе типов клеток, которые знакомы тем, кто имеет опыт в данной области техники. Соединения, созданные для воспроизведения рецептор-связывающих свойств ВКП (т.е. миметики), также входят в это определение и включены в изобретение.
Особенно предпочтительные воплощения реагентов изобретения включают:
HSDAVFTDNYTRLRKQMAVKKYLNSILNC(CH2CO,( β - Dap)KCK. амид).амид
HSDAVFTDNYTRLRKQMAVKKYLNSILNC(CH2CO, GGСК.амид).амид
HSDAVFTDNYTRLRKQMAVKKYLNSILNC(CH2CO, ( δ -Orn)GСК.амид).амид
HSDAVFTDNYTRLRKQMAVKKYLNSILNC(BAT).aмид
HSDAVFTDNYTRLRKQMAVKKYLNSILNGGC.амид
HSDAVFTDNYTRLRKQMAVKKYLNSILNC(CH2CO, GGCE.амид)амид и
HSDAVFTDNYTRLRKQMAVKKYLNSILNC( ε , K)GC.амид.
Аббревиатуры всех существующих в природе аминокислот даны с использованием стандартных аббревиатур (которые можно найти у G.Zubay, Biochemistry (2d. ed.), 1988 (MacMillen Publishing: New York) p. 33). Для целей этого изобретения, все существующие в природе аминокислоты характеризуются как липофильные (аланин, изолейцин, лейцин, метионин, фенилаланин, тирозин, пролин, триптофан и валин, а также S - алкилированные производные цистеина), гидрофильные (аспарагин, глутамин, треонин, серин), кислотные (глутаминовая кислота и аспартамовая кислота), основные (аргинин, гистидин и лизин). ε -K представляет собой ковалентную связь через ε -аминогруппу в боковой цепи остатка лизина. δ - Orn представляет собой остаток орнитина, в котором δ -аминогруппа, а не типичная α - аминогруппа, ковалентно связана с карбоксильной группой соседней аминокислоты с образованием пептидной связи. γ - Dab представляет собой остаток 2,4 - диаминобутановой кислоты, в котором γ - аминогруппа ковалентно связана с карбоксильной группой соседней аминокислоты с образованием пептидной связи. β - Dap представляет собой остаток 1,3 - диаминопропионовой кислоты, в котором β - аминогруппа ковалентно связана с карбоксильной группой соседней аминокислоты с образованием пептидной связи. (ВАТ) представляет собой N6, N9 - бис (2-меркапто-2-метилпропил)-6, 9-диазанонановую кислоту; К. (ВАТ) и Lys. (ВАТ) представляют собой лизин, ацилированный по ε - аминогруппе боковой цепи с образованием (ВАТ); С (ВАТ) и Cys (ВАТ) представляют собой S -(N6, N9 - бис(2-меркапто-2-метилпропил)- 6, 9 -диазанонан-1-ил) цистеин; (ВАМ) является N1, N4- бис (2-меркапто -2-метилпропил)-1,4,10-триазадеканом); (BAT - BM) является N-{2-(N', N'- бис(2-малеимидоэтил)аминоэтил} -N9 -(t-бутоксикарбонил)-N6, N9-бис(2-меркапто-2- метилпропил)-6, 9-диазанонанамидом; (BAT - BS) является N-{ 2-(N',N'- бис(2-сукцинимидоэтил)аминоэтил} -N6, N9 - бис(2-меркапто-2-метилпропил)-6,9-диазанонанамидом; (BMME) является бис-малеимидоэтиловым эфиром; и (BSME) является бис - сукцинимидометиловым эфиром. Как используется здесь, подразумевается, что следующие аминокислоты и аналоги аминокислот представлены следующими аббревиатурами: Acm является сульфогидрильной защитной группой ацетамидометила; Pen является пеницилламином; Aca является 6 - аминокапроновой кислотой; Hly является гомодизином; Ape является L-{S-(3-аминопропил)цистеином} , d является D - фенилаланином; Wd является D - триптофаном; Yd является D - тирозином; Cpa является L-(4-хлорфенил) аланином; Thp является 4-амино-тетрагидротиопиран-4 - карбоновой кислотой; D - Nal является D-2-нафтилаланином; Dpg является дипропилглицином; Nle является норлейцином; Hcy является гомоцистеином; Hhc является гомогомоцистеином; Aib является аминоизобутановой кислотой; Nal является 2 - нафтилаланином; D - Nal является D-2-нафтилаланином; Ain является 2 - аминоиндан - 2 - карбоновой кислотой; Achxa является 4 -амино-циклогексилаланином; Amf является 4 -аминометил-1-фенилаланином; Aec является S-(2- аминоэтил) цистеином; Apc является S-(3-аминоппропил) цистеином; Aes является О-(-2-аминоэтил) серином; Apc является О-(3-аминоппропил) серином; Abu является 2 - аминобутановой кислотой; и Nva является норвалином.
Рецептор-связывающие вазоактивные кишечные пептиды и их производные и аналоги, обеспеченные настоящим изобретением, могут быть синтезированы химически in vitro. Пептиды настоящего изобретения большей частью могут быть преимущественно получены на пептидном синтезаторе. При синтезе пептидов настоящего изобретения хелатирующая составляющая, или уникальная связывающая составляющая для хелатирующего агента, ковалентно связывается с пептидом во время химического синтеза in vitro, причем подобные химические превращения хорошо известны тем, кто имеет опыт в данной области техники. Такие пептиды, ковалентно связанные с хелатирующей составляющей, или уникальной связывающей составляющей хелатирующего агента, во время синтеза являются более выгодными, потому что можно определить специфические участки ковалентного связывания.
Хелатирующие составляющие изобретения вводятся в целевой вазоактивный кишечный пептид, производное или аналог, либо во время пептидного синтеза, либо путем связывания с уникальной аминокислотой, включенной в вазоактивный кишечный пептид во время пептидного синтеза. Так, цистеин или гомоцистеин могут быть включены в специфический участок пептида во время пептидного синтеза и после этого хелатирующая составляющая может быть ковалентно сайт - специфично связана с тиольными группами цистеина или гомоцистеина. Это изобретение предусматривает включение хелатирующих составляющих сайт - специфичным образом фактически в любой участок пептида. В частности, изобретение обеспечивает производные аминокислот, включающие меченные радиоактивным изотопом хелатирующие составляющие, связанные с боковой цепью аминокислоты, где либо хелатор, либо уникальная аминокислота, с которой в последствие хелатор может быть сайт - специфично связан, включены в пептид во время пептидного синтеза in vitro в специфический участок пептида. Изобретение обеспечивает также пептиды, где меченые хелатирующие составляющие включены в пептид в карбоксильную терминальную группу. В предпочтительных вариантах осуществления, меченая хелатирующая составляющая включена в или на боковую цепь аминокислоты синтетического вазоактивного кишечного пептида, где аминокислота является природной или заменимой аминокислотой в пептидной последовательности.
- SDAVFTDNYTRLRKQMAVKKYLNSILN. амид
В других предпочтительных вариантах воплощения, меченая хелатирующая составляющая включена в синтетический вазоактивный кишечный пептид на участке, находящемся в боковой цепи аминокислоты, где аминокислота является природной или заменимой аминокислотой в пептидной последовательности.
- NYTRLRKQMAVKKYLNSILN. амид
В других предпочтительных вариантах воплощения, меченая хелатирующая составляющая включена в синтетический вазоактивный кишечный пептид на участке, находящемся в боковой цепи природной или заменимой аминокислоты пептида, где аминокислота является аминокислотой следующей пептидной последовательности;
- KQMAVKKYLNSILN. амид
В следующих других предпочтительных вариантах, меченая хелатирующая составляющая включена в синтетический вазоактивный кишечный пептид в терминальную карбоксильную группу пептида.
Особым преимуществом реагентов изобретения является то, что они имеют меченую хелатирующую составляющую, включенную в пептид во время синтеза, или уникальную аминокислоту, с которой в последствие хелатор может быть сайт - специфично связан. Это позволяет прикрепить хелатор на известный участок вазоактивного кишечного пептида или фрагмента, аналога или производного вазоактивного кишечного пептида таким образом, чтобы избежать снижения сродства пептида к рецептору ВКП. Известные способы введения в пептиды хелаторов были преимущественно основаны на способах, разработанных впервые для белка, который будучи много больше пептида, не столь чувствительны к не - сайт - специфичному введению хелатирующей составляющей. Пептиды, полученные с применением известных способов, менее выгодны по сравнению с сайт - специфичным введением хелаторов в пептиды изобретения. Это объясняется вероятностью того, что при введении хелатора известными способами связывающее сродство пептида будет снижено.
Преимуществом этого изобретения является также то, что пептиды обеспечиваются как химически синтезированные пептиды. Это объясняется тем, что химический синтез представляет собой контролируемый процесс, легко поддающийся методам химической инженерии, которые способны обеспечить качественный и фармацевтически пригодный продукт. Способам химического синтеза отдается предпочтение перед прочими способами, такими, как биологический синтез и экстракция, которые могут включать в себя внесение патогенных организмов (вирусов, микоплазмы и т. д.), которое потребует больших расходов на их удаление или проверку их отсутствия. Получение продуктов химическим синтезом является более дешевым, и за полученными продуктами легче вести контроль, что является преимуществом для их фармацевтического и коммерческого применения.
При образовании комплекса радиоактивного технеция с реагентами этого изобретения, комплекс технеция, предпочтительно соль пертехнетата Tc-99m, взаимодействует с реагентом в присутствии восстанавливающего агента. Предпочтительными восстанавливающими агентами являются дитионит-ион, ионы олова и железа; наиболее предпочтительным восстанавливающим агентом является хлорид олова. Способы получения таких комплексов осуществляют с использованием набора, включающего герметичный сосуд, содержащий определенное заранее количество любого реагента изобретения, который будет помечен, и достаточное количество восстанавливающего агента для мечения реагента Tc-99m. Другим образом, этот комплекс может образовываться при взаимодействии реагента этого изобретения с образованным заранее лабильным комплексом технеция и другого соединения, известного как лиганд - переносчик. Этот процесс известен как обмен лигандов и хорошо известен тем, кто имеет опыт в данной области техники. Лабильный комплекс можно получить с использованием таких лигандов - переносчиков, как, например, тартрат, цитрат, глюконат или маннит. В числе солей пертехнетата Tc-99m, пригодных в настоящем изобретении, включены такие соли щелочных металлов, как натриевая соль, соль аммония или соли низшего алкиламмония.
В предпочтительном варианте воплощения обеспечено оборудование для меченых технецием или рением пептидов. Соответствующее количество пептидного реагента вносится в сосуд, содержащий восстанавливающий агент, такой как хлорид олова, в количестве, достаточном для мечения пептида Tc-99m, Re-186 или Re-188. Также может быть внесено соответствующее количество описанного выше лиганда - переносчика (такого, как, например, тартрат, цитрат, глюконат, глюкогептанат или маннит). Оборудование может также включать в себя такие обычные фармацевтические дополнительные материалы, как фармацевтически приемлемые соли для установления осмотического давления, буферы, фиксаторы и т. д. Компоненты оборудования могут находиться в жидкой, застывшей или сухой форме. В предпочтительном варианте воплощения компоненты оборудования обеспечиваются в лиофилизированной форме.
По настоящему изобретению, меченные Tc-99m, Re-86 и Re-88 рентгенофармацевтические препараты можно получить при добавлении в сосуды соответствующего количества Tc-99m, Re-186 или Re-188, или их радионуклидных комплексов, и проведении реакции в условиях, описанных ниже в Примере 2.
Радиоактивно-меченые сцинтиграфические отображающие агенты, обеспеченные настоящим изобретением, имеют необходимое количество радиоактивности. Обычно при образовании радиоактивных комплексов Tc-99m предпочитают, чтобы радиоактивные комплексы образовывались в растворах, концентрация радиоактивности в которых находится в пределах от около 0,01 милликюри (мКи) до 100 мКи в мл.
Отображающие агенты, обеспеченные настоящим изобретением, можно использовать для визуализации участков экспрессии или гиперэкспрессии рецепторов ВКП, включая такие органы, как прямая кишка, для диагностики нарушений в этих органах, и опухоли, в частности, желудочно-кишечные опухоли, в особенности кишечно-ректальные опухоли, которые можно отобразить. В соответствии с эти изобретением, меченные Tc - 99m пептидные реагенты вводятся в виде единичной инъекционной дозы. Меченные Tc - 99m пептидные реагенты, обеспеченные настоящим изобретением, можно вводить внутривенно в любой подходящей для внутривенных инъекций среде, в такой, как среда водного физиологического раствора или среда плазмы крови. Как правило, радиоактивность единичной вводимой дозы составляет от около 0,01 мКи до около 100 мКи, предпочтительно от 1 мКи до 20 мКи. Единичная доза инъектируемого раствора составляет от около 0,01 мл до около 10 мл. Отображение в материи in vivo происходит спустя несколько минут после внутривенного введения. Однако, по желанию, отображение может произойти спустя часы и даже больше после введения пациенту инъекции меченого пептида. В большинстве случаев, количество введенной дозы, достаточное для того, чтобы можно было сделать сцинтилляционные снимки накопится в области, которую нужно отобразить, в течение 0,1 часа. В соответствии с этим изобретением можно использовать любой обычный способ сцинтиграфического отображения.
Это изобретение обеспечивает также пептиды, меченные такими цитотоксичными радиоактивными изотопами, как рений -186 или рений-88, которые можно использовать для рентгенотерапии некоторых опухолей, как описано выше. Для этой цели радиоактивный изотоп в количестве от около 10 мКи до около 200 мКи может быть введен через любой клинический путь, предпочтительно путем внутривенной инъекции.
Это изобретение обеспечивает также ВКП рецептор-связывающие вазоактивные кишечные пептиды, ковалентно связанные с металл-связывающими составляющими, которые образуют комплекс с магнитными, парамагнитными, супермагнитными или суперпарамагнитными атомами, ионами или частицами металла, и способы использования таких комплексов для магнитно-основанного определения локализации подобных рецептор-связывающих вазоактивных кишечных пептидных комплексов в опухоли или других участках ткани in vivo. Таким образом, настоящее изобретение обеспечивает нерадиоактивные способы локализации опухоли и других тканей, выражающих вазоактивные кишечные рецепторы in vivo.
Это изобретение предусматривает способы использования диагностических и рентгенодиагностических, и терапевтических и рентгенотерапевтических агентов изобретения. Для воплощений меченых агентов изобретения, например, меченных Tc-99m сцинтиграфических отображающих агентов, вводится эффективное диагностическое или терапевтическое количество диагностического или рентгенодиагностического, или терапевтического или рентгенотерапевтического агента изобретения. В рентгенодиагностических воплощениях, локализацию радиоактивной метки определяют с использованием обычных методов, таких, как гамма-сцинтиграфия. В нерадиоактивных диагностических воплощениях, локализация участков накопления диагностических агентов, меченных парамагнитным металлом, достигается при использовании для отображения методов магнитного резонанса. Для целей этого изобретения, рентгенотерапия определяется как терапевтическое воздействие, простирающееся от временного облегчения боли до лечения.
Отображающие агенты, обеспеченные настоящим изобретением, используются для отображения опухолей, в частности для отображения первичных и участков неоплазмы с метастазами, где упомянутые клетки неоплазмы экспрессируют рецепторы ВКП, и в частности таких первичных и в особенности кишечно-ректальных опухолевых клеток с метастазами, которые не поддаются клиническому обнаружению с использованием обычных методов.
Имеющие опыт в данной области техники знают, что эффективные рентгенофармацевтические препараты можно идентифицировать, протестировать и охарактеризовать с использованием любого из числа методов in vitro, известных в данной области техники. Такие методы включают, inter alia, определение констант диссоциации или констант ингибирования при связывании рентгенофармацевтических препаратов изобретения со своими родственными рецепторами ВКП, а также сравнение сродства или тяготения такого связывания со связыванием меченого, например, 125I - меченого ВКП самого по себе, и в экспериментах, где рентгенофармацевтические препараты изобретения используются в сравнении с мечеными ВКП, или во встречных экспериментах с использованием не меченого ВКП в сравнении с рентгенофармацевтическими препаратами изобретения.
В практике этого изобретения, эффективные рентгенодиагностические и рентгенотерапевтические агенты получают следующим образом. Реагенты изобретения, включающие рецептор связывающие вазоактивные кишечные пептиды и фрагменты рецептор связывающих вазоактивных кишечных пептидов, их аналоги и производные, синтезируют с использованием способов изобретения, где хелатирующая составляющая включена в пептид во время химического синтеза. После этого реагенты изобретения образуют комплексы с рением, предпочтительно в виде ReO комплекса, как будет раскрыто далее. Связывание ВКП рецептора оценивают затем в сравнительных in vitro пробах, как описано здесь, с использованием радиойодированного ВКП, как раскрыто в примере 4.
Способы получения и мечения этих соединений иллюстрированы более полно в следующих примерах. Эти примеры иллюстрируют некоторые аспекты вышеописанного метода и результаты, не ограничивая объем изобретения.
ПРИМЕР 1
Синтез ВАТ хелаторов
А. Синтез N-Boc-N'-(5-карбоксипентил)-N, N'-бис(2- метил-2-трифенилметилтиопропил) этилендиамина.
а. 2-метил-2 (трифенилметилтио) пропаналь
Трифенилметилмеркаптан (362.94 г, 1,31 моль, 100 мол%), растворенный в безводном ТГФ (тетрагидрофуран; 2 л), охладили в ледяной бане под аргоном. В течение 20 минут порциями прибавляли гидрид натрия (60% в масле; 54,39 г, 1,35 моль, 104 мол.%). Затем в течение 20 минут медленно прибавили 2-бром-2-метилпропаналь (206.06 г, 1.36 моль, 104 мол.%, см. Stevens & Gillis, 1957, J. Amer. Chem. Soc, 79: 3448 - 51). Реакционную смесь довели до комнатной температуры и перемешивали 12 часов. Реакцию погасили водой (1 л) и экстрагировали диэтиловым эфиром (3 x 1 л). Эфирные экстракты объединили, промыли насыщенным раствором NaCl (500 мл), высушили над Na2SO4 и отфильтровали. Растворитель удалили в вакууме, получив густое оранжевое масло. Сырое масло растворили в толуоле (200 мл) и разбавили горячим гексаном до объема 2 л. Смесь отфильтровали через воронку для фильтрования и выдержали при 5oC в течение 12 часов. Выпавший белый кристаллический осадок отфильтровали, получив 266,36 г (выход 59%) целевого соединения. Tемпература плавления целевого соединения составила 83 - 85oC. Эксперименты по характеристике ядерным магнитным резонансом дали следующие молекулярные значения:
ПМР (300 МГц, CDCl3): 1,24 (с, 6H, 2CH3), 7,2-7,35 (м, 9H), 7,59 - 7,62 (м, 6H), 8.69 (с, H, -COH)
ЯМР 13C (75 МГц, CDCl3): δ 22.86, 55.66, 67.48, 126.85, 127.75, 129.72, 144.79, 197.31.
b. N,N'- бис(2-метил-2-трифенилметилтиопропил) этилендиамин.
К 2-метил-2(трифенилметилтио)пропаналю (13,86 г, 0.0401 моль, 206 мол. %), растворенному в метаноле (40 мл) и безводном ТГФ (40 мл), под аргоном прибавили этилендиамин (1.3 мл, 0.0194 моль, 100 мол.%), и довели pH до pH 6 добавлением по каплям уксусной кислоты. Раствор перемешивали 20 минут при 20oC. Прибавили цианоборгидрид натрия (1,22 г, 0,0194 моль, 100 мол.%) и перемешивали реакционную смесь в течение 3 часов при комнатной температуре. Прибавили дополнительное количество цианоборгидрида натрия (1,08 г) и перемешивали реакционную смесь в течение 17 часов при 20oC. Прибавили последнюю порцию цианоборгидрида натрия (1.02 г) и кипятили реакционную смесь в течение 6 часов под аргоном. Реакционную смесь разбавили 0,5 М HCl (100 мл) и экстрагировали этилацетатом (2 x 100 мл). Органические экстракты объединили, последовательно промыли 2 М NaOH (60 мл), насыщенным раствором NaCl (60 мл), высушили над Na2SO4 и отфильтровали. Растворитель удалили в вакууме, получив 16,67 г сырого продукта, который кристаллизовали из смеси толуол/гексан, получив в результате 10,20 г (выход 73%) белых кристаллов целевого соединения. Tемпература плавления полученного соединения составила 83 - 86oC. По результатам FABMS анализа величина m/z составила 721 (МН+).
Эксперименты по характеристике ядерным магнитным резонансом дали следующие молекулярные значения:
ПМР (300 МГц, CDCl3): δ 1,12 (с, 12H, 4CH3), 1,64 (с, 4H, N-CH2-C(Me)2-S), 2,52 (с, 4H, N-CH2-CH2-N), 5,31 (с, 2H, 2-NH), 7,12-7,30 (м, 18H, Ar), 7,62-7,65 (м, 12H, Ar).
c. N-(5-карбоэтоксипентил)-N, N'-бис(2-метил-2-трифенилметилтиопропил) этилендиамин
К раствору N, N'-бис(2-метил-2-трифенилметилтиопропил) - этилендиамина (10,03 г, 13,9 ммоль) в CH3CN (60 мл) прибавили К2CO3 (1,92г, 13,9 ммоль, 100 мол. %), после чего прибавили этил-5-бромовалерат (3,30 мл, 20,8 ммоль, 150 мол. %). Реакционную смесь кипятили под аргоном в течение ночи. Затем раствор сконцентрировали до состояния пасты и распределили его между 0,25 М КОН (100 мл) и этилацетатом (100 мл). Водный слой экстрагировали этилацетатом (1 x 50 мл), объединенные этилацетатные слои промыли 50 мл воды и раствора NaCl (50 мл), высушили над Na2SO4 и сконцентрировали, получив оранжевое масло. Очистка методом флэш-хроматографии (300 г флэш-силикагеля, 100% CHCl3 к 5% МеОН/CHCl3) привела к чистому целевому продукту (7,75 г, выход 66%). По результатам FABMS анализа величина (МН+) составила 849 (в сравнении с рассчитанной молекулярной массой 849,24 для соединения C55H64N2O2S2)
d. N-Воc-N'-(5-карбоксипентил)-N, N'-бис(2-метил-2- трифенилметилтиопропил)этилендиамин
К N-(5-карбоэтоксипентил)-N, N'-бис(2-метил-2-трифенилметилтиопропил) этилендиамину (7,75 г, 9,13 ммоль) в диоксане (200 мл) прибавили 1 М КОН (25 мл, 25,0 ммоль, 274 мол.%), после чего добавили воду (250 мл). Затем при перемешивании прибавляли по каплям диоксан до получения гомогенного раствора. Реакционную смесь нагревали при слабом кипении в течение ночи. Большую часть диоксана удалили на роторном испарителе, а pH раствора довели до ~7-8 1 М KH2PO4 и насыщенным раствором NaHCO3. После этого раствор экстрагировали этилацетатом (3 x 75 мл), а объединенные органические слои промыли раствором NaCl (50 мл), высушили над Na2SO4 и сконцентрировали до состояния пена/твердое вещество (6,35 г, выход 85%). К сырому продукту описанной выше реакции прибавили (BOC)2O (3,35 г, 15,4 ммоль, 200 мол.%), CH3CN (50 мл) и хлористый метилен (50 мл), после чего прибавили триэтиламин (1,0 мл, 7,2 ммоль, 93 мол.%). Реакционную смесь перемешивали при комнатной температуре под аргоном в течение ночи. Затем реакционную смесь сконцентрировали и распределили между водой (100 мл) и этилацетатом (50 мл). Водный слой экстрагировали этилацетатом (1 x 50 мл), а объединенные этилацетатные слои промыли 5% лимонной кислотой и раствором NaCl (по 50 мл каждым), затем высушили (Na2SO4) и сконцентрировали в оранжевое масло. Очистка методом флэш-хроматографии (200 г флэш силикагеля, 100% CHCl3 к 5% метанол/хлороформ) привела к чистому целевому соединению (2,58 г, выход 36%). По результатам FABMS анализа величина (МН+) составила 921 (в сравнении с рассчитанной молекулярной массой 921.31 для соединения C58H68N2O4S2)
В. Синтез N-Воc-N'-(5-карбоксипентил)-N,N'-бис-[2-(4-метоксибензилтио) -2-метилпропил]этилендиамина
a. N,N'-бис-[2-(4-метоксибензилтио)-2-метилпропил] этилендиамин
Раствор N,N'-бис-[2-меркапто-2-метилпропил] этилендиамина (11,23 г, 47,5 ммоль; CM. DiZio et al. , 1991, Bioconjugate Chem 2: 353 и Corbin et al., 1976, J. Org, Chem. 41:. 489) в метаноле охлаждали в водно-ледяной бане и затем насыщали газообразным аммиаком в течение 45 минут. К этому прибавили 4 - метоксибензилхлорид (17,0 мл, 125 ммоль, 264 мол.%). Реакционную смесь довели до комнатной температуры при перемешивании под аргоном в течение ночи. Раствор сконцентрировали до состояния пасты и затем распределили его между диэтиловым эфиром (150 мл) и 0,5 М КОН (200 мл). Далее водный слой экстрагировали диэтиловым эфиром (2 x 50 мл). Объединенные органические слои промыли раствором NaCl и сконцентрировали в прозрачное бесцветное масло. Это масло растворили в диэтиловом эфире (200 мл) и затем подкисляли 4,0 М HCl в диоксане до тех пор, пока не прекратилось выпадение осадка. Белый осадок выделили фильтрованием и промыли диэтиловым эфиром. Белый осадок снова кристаллизовали из горячей воды при pH ~2. Продукт выделили фильтрованием, получив 29,94 г в виде смеси моно - и ди-солей HCl. Соли HCl были распределены между 1 М КОН (100 мл) и этилацетатом (100 мл). Водный слой экстрагировали этилацетатом (2 x 30 мл), а объединенные органические слои промыли раствором NaCl, высушили над Na2SO4 и сконцентрировали, получив чистый продукт в виде свободного основания, представляющий собой светлое желтое масло (18,53г, выход 82%).
Эксперименты по характеристике ядерным магнитным резонансом дали следующие молекулярные значения: ПМР (300 МГц, CDCl3): δ 7,25 (д, 4H, J=9), 6,83 (д, 4H, J=9), 3,78 (с, 6H), 3,67 (с, 4H), 2,63 (с, 4H), 2,56 (с, 4H), 1,34 (с, 12H).
b. N-(5-карбоэтоксипентил)-N,N'-бис-[2-(4-метоксибензилтио) -2-метилпропил]этилендиамин
К N,N'-бис-[2-(4-метоксибензилтио)-2-метилпропил]этилендиамину (4,13 г, 8,66 ммоль) в CH3CN (50 мл) прибавили К2CO3 (1,21г, 8,75 ммоль, 101 мол.%), после чего прибавили этил-5-бромовалерат (2,80 мл, 17,7 ммол, 204 мол.%). Кипящую реакционную смесь перемешивали в течение ночи и затем сконцентрировали в вакууме до состояния пасты. Остаток распределили между этилацетатом (100 мл) и 0,5 М КОН (100 мл). Водный слой экстрагировали этилацетатом (1 x 50 мл), а объединенные этилацетатные слои промыли раствором NaCl (50 мл), высушили над Na2SO4 и сконцентрировали в желтое масло (~6 г). Очистка нормально - фазовой препаративной ЖХВД (100% CHCl3 к 5% метанол/хлороформ за 25 минут) привела к чистому целевому соединению (1,759 г, выход 34%). По результатам FABMS анализа величина (МН +) составила 605 в сравнении со значением 604,90, рассчитанным для соединения C33H52N2O4S2). Эксперименты по характеристике ядерным магнитным резонансом дали следующие молекулярные значения:
ПМР (300 МГц, CDCl3): δ 7,25 (д, 4H, J = 8,5), 6,83 (д, 4H, J = 8,5), 4,13 (кв, 2H, J=7), 3,793 (c, 3H), 3,789(с, 3H), 3,74(c, 2H), 3,67 (с, 2H), 2,6 (м, 10H), 2,31 (т, 2H, J=7), 1,6 (м, 2H), 1,5 (м, 2H), 1,34 (с, 12H), 1,28 (т, 3H, J=7).
с. N-Воc-N'-(5-карбоксипентил)-N, N'-бис-[2-(4-метоксибензилтио) -2-метилпропил]этилендиамин
К N-Воc-N'-(5-карбоэтоксипентил)-N,N'-бис-[2-(4-метоксибензилтио) -2-метилпропил] этилендиамину (586 г, 0,969 ммоль) в ТГФ (40 мл) прибавили воду (30 мл) и 1 М КОН (2,5 мл, 2,5 ммоль, 260 мол.%). Гомогенный раствор нагревали при слабом кипении в течении ночи. Затем раствор охладили до комнатной темпера туры и удалили ТГФ на роторном испарителе. Остаток разбавили H2O до объема 50 мл и довели pH до ~2-3 1 М HCl. Водный раствор экстрагировали этилацетатом (3 x 30 мл), а объединенные органические слои промыли раствором NaCl (50 мл), высушили над Na2SO4 и сконцентрировали, получив сырую кислоту (422 мг, выход 75%).
К сырому продукту описанной выше реакции прибавили CH3CN (40 мл) и (ВОС)2O (240 мг, 1,10 ммоль, 150 мол.%), после чего прибавили триэтиламин (0,200 мл, 1,43 ммоль, 196 мол.%). Гомогенный раствор перемешивали при комнатной температуре в течение ночи. Затем раствор сконцентрировали до состояния пасты и распределили его между этилацетатом (25 мл) и 1 М KH2PO4 (25 мл). Органический слой промыли 5% лимонной кислотой (2 x 25 мл) и раствором NaCl (25 мл), высушили над Na2SO4 и сконцентрировали в желтое масло. Очистка методом флэш - хроматографии (50 мл) флэш-силикагеля, 100% хлороформ к 15% метанол/хлороформ) привела к чистому целевому соединению (344 мг, выход 70%). По результатам FABMS анализа величина (MH+) составила 677 (в сравнении со значением 676,97, рассчитанным для соединения C36H56N2O6S2).
Эксперименты по характеристике ядерным магнитным резонансом дали следующие молекулярные значения:
ПМР (300 МГц, CDCl3): δ 7,20 (д, 4H, J=7), 6,79 (д, 4H, J=7), 3,75 (с, 3H), 3,74 (с, 3H), 3,68 (м, 4H), 3,35 (м, 4H), 2,65 (м, 2H), 2,53 (м, 4H), 2,31 (м, 2H), 1,59 (м, 2H), 1,43 (с, 11H), 1,30 (с, 6H), 1,26 (с, 6H).
С. Синтез ВАТ - ВМ(N-[2-(N',N'-бис(2-малеимидоэтил)аминоэтил)]-N6,N9 - бис(2-метил-2-трифенилметилтиопропил)-6,9 диазанонанамида)
ВАТ - ВМ получали следующим образом. ВАТ кислоту (N9- (t-бутоксикарбонил-N6, N9-бис(2-метил-2- трифенилметилтиопропил)-6,9 диазановую кислоту) (10,03 г, 10,89 ммоль) и 75 мл сухого хлористого метилена (CH2Cl2) поместили в круглодонную колбу на 250 мл, снабженную магнитной мешалкой и аргоновым баллоном. К этому раствору прибавили диизопропилкарбодиимид (3,40 мл, 21,7 ммоль, 199 мол.%), после чего прибавляли N-гидроксисукцинимид (3,12 г, 27,1 ммоль, 249 мол.%). В течение 1 часа раствор помутнел и далее его выдерживали при перемешивании в общей сложности 4 часа при комнатной температуре. Затем прибавили раствор трис(2-аминоэтил) амина (30 мл, 200 ммоль, 1840 мол.%) в 30 мл хлористого метилена и продолжали перемешивать в течение ночи. Затем реакционную смесь сконцентрировали в вакууме и распределили остаток между этилацетатом (150 мл) и 0,5 М карбонатом калия (К2CO3, 150 мл). Органический слой отделили, промыли раствором соли и сконцентрировали, получив сырой продукт N-[2-(N',N'-бис(2- аминоэтил)аминоэтил)]-N9-(t-бутоксикарбонил)-N6, N9 -бис(2-метил-2-трифенилметилтиопропил)-6,9 диазанонанамида в виде пены/масла.
Сырой продукт поместили в круглодонную колбу на 1000 мл с магнитной мешалкой, в которой находилось 300 мл ТГФ, и затем прибавили 30 мл насыщенного раствора бикарбоната натрия (NaHCO3), 100 мл воды и N-метоксикарбонилмалеимида (6,13 г, 39,5 ммоль, 363 мол.%). Эту гетерогенную смесь перемешивали в течение ночи при комнатной температуре. ТГФ удалили из смеси на роторном испарителе, а водный раствор дважды экстрагировали этилацетатом (2 x 75 мл). Объединенные органические слои из этих экстракций промыли раствором соли, высушили над сульфатом натрия, отфильтровали через среднюю фритту и сконцентрировали, получив 12 г сырого продукта. Очистка методом жидкостной хроматографии (250 г силикагеля/элюирование с градиентом хлороформ ---> 2% метанола в хлороформе) привела к 5,3 г чистого продукта (N-[2-(N',N'-бис(2 -малеимидоэтил)аминоэтил)] -N9-(t-бутоксикарбонил)-N6, N9-бис(2-метил-2-трифенилметилтиопропил)-6,9 диазанонанамида) (эквивалентного выходу 40%), наряду с приблизительно 5 г сырого продукта, который можно повторно очистить для получения чистого продукта. Химический анализ очищенного продукта подтвердил его идентичность с ВАТ - ВМ; что следует из:
ПМР (200 МГц, CDCl3): δ 0,91 (12H, с), 1,38 (9H, с), 1,2-1,6 (4H, м), 2,06 (2H, с), 2,18 (2H, т, J = 7), 2,31 (4H, м), 2,55 (2H, т, J = 5), 2,61 (4H, т, J = 6), 2,99 (2H, с), 3,0-3,3 (4H, м), 3,46 (4H, т, J = 6), 6,49(-NH, т, J=4), 6,64 (4H, с), 7,1-7,3 (18H, м), 7,6 (12H, т, J=17).
D. Синтез [BAT] - конъюгированного (eN) Lys (aN-Fmoc) [N-e-(N9-1-бутоксикарбонил)-N6,N9 - бис(2-метил-2-(трифенилметилтио)пропил]-6,9-диазанонаноил) -N-а-Fmoc-лизина.
В одногорлую круглодонную колбу на 100 мл, снабженную ме шалкой и аргоновым баллоном, загрузили N9-(t-бутоксикарбонил)-N6, N9-бис[2-метил- 2-(трифенилметилтио)пропил] -6,9-диазанонановую кислоту (ВАТ кислоту: 3,29 г, 3,57 ммоль) в 50 мл CH2Cl при комнатной температуре. К этому прибавили диизопропилкарбодиимид (DIC: 580 мкл, 3,70 ммоль, 104 мол%), после чего сразу прибавили N-гидроксисукцинимид (HOSu: 432 мг, 3,75 ммоль, 105 мол.%). Реакционную смесь перемешивали при комнатной температуре в течение ночи, за время которой образовался белый осадок. Смесь отфильтровали и сконцентрировали фильтрат в твердую пену. В круглодонной колбе на 100 мл сырую пену растворили в 75 мл смеси диметоксиэтана и воды (2:1). К этому гомогенному раствору прибавили гидрохлорид N-а-Fmoc-лизина (1,52 г, 3,75 ммоль, 105 мол.%), после чего прибавили K2CO3 (517 мг, 3,74 ммоль, 105 мол.%) и желтый раствор перемешивали при комнатной температуре в течение ночи. Затем этот раствор вылили в колбу Эрленмейера на 250 мл, в которой находилось 100 мл этилацетата и 100 мл воды. Органический слой отделили, а водный раствор далее экстрагировали 50 мл этилацетата. Объединенные органические слои один раз промыли раствором
соли (100 мл), высушили над сульфатом натрия и сконцентрировали в желтый твердый остаток. Этот сырой продукт очистили методом жидкостной хроматографии под пониженным давлением (150 г SiO2, элюирование CHCl3 ---> 10% метанола в CHCl3). Таким образом было получено 3,12 г обозначенного соединения (выход 69%). Химический анализ очищенного продукта подтвердил его идентичность с ВАТ - ВМ; что следует из:
ПМР (300 МГц, CDCl3): δ 0,88 (12H, с, уширенный), 1,05-1,45 (19H, м), 1,8-2,1 (4H, м), 1,8-2,47 (4H, м), 2,75-3,2 (6H, м), 3,9- 4,3 (4H, м), 7,2 (22H, м), 7,6 (16H, с, связанный). Предсказанное FABMS значение MH+ составило 1270,6 и оказалось равным 1272.
Е. Синтез ВАМ (N1-(t-бутоксикарбонил)-N1,N4 -бис[2-метил-2-(трифенилметилтио)пропил]-1,4,10-триазадекана).
В одногорлую круглодонную колбу на 250 мл, снабженную мешалкой, обратным холодильником и аргоновым баллоном, загрузили N1, N4-бис[2-метил-2-(трифенилметилтио)пропил] - этилендиамин (ВАТ-I; 10,0 г, 14,01 ммоль) в 50 мл CH3CN и 30 мл диоксана. К этому прибавили N-(5-бромпентил)-фталимид (8,04 г, 27,1 ммоль, 194 мол.%), после чего прибавили K2CO3 (2,95 г, 21,3 ммоль, 152 мол. %). Смесь кипятили под аргоном 2 дня. После этого раствор сконцентрировали и распределили остаток между 150 мл воды и 150 мл этилацетата. Органический слой отделили, а водный раствор далее экстрагировали 50 мл этилацетата (при pH около 10). Объединенные органические слои один раз промыли раствором соли (75 мл), высушили над NaCO3 и сконцентрировали в масло. Очистка методом жидкостной хроматографии под пониженным давлением (300 г SiO2, CHCl3 ---> 2% метанола в CHCl3) дала 9,20 г 9-фталимидо-N1,N4-бис[2-метил-2- (трифенилметилтио)пропил] -1,4-диазонана в виде желтой пены (выход 70%). Химический анализ очищенного продукта этого интермедиата подтвердил его идентичность; что следует из:
ПМР (300 МГц, CDCl3): δ 1,01 (6H, с), 1,03 (6H, с), 1,15-1,4 (2H, т), 1,98 (2H, с), 2,10 (2H, с), 2,28 (2H, м), 2,45 (3H, м), 3,68 (2H, т), 7,17-7,35 (18H, м), 7,62 (12H, т), 7,72 (2H, м), 7,85 (2H, м). Предсказанное FABMS значение MH+ составило 935,4 и оказалось равным 936.
В одногорлую круглодонную колбу на 500 мл, снабженную мешалкой, загрузили 9-фталимидо-N1, N4- бис[2-метил-2-(трифенилметилтио)пропил]-1,4-диазанонан (8,83 г, 9,43 ммоль) в 75 мл CH3CN и 20 мл CH2Cl2. К этому прибавили K2CO3 (1,30 г, 9,41 ммоль, 100 мол.%), после чего прибавили ди-третбутилдикарбонат (2,15 г, 9,85 ммоль, 104 мол.%) и перемешивали реакционную смесь при комнатной температуре в течение ночи. Затем реакционную смесь сконцентрировали и распределили между водой и этилацетатом, по 100 мл каждого. Органический слой отделили, а водный далее экстрагировали 50 мл этилацетата. Объединенные органические слои промыли 1 раз раствором (75 мл), высушили над Na2SO4 и сконцентрировали, получив 9,69 г сырого 9-фталимидо-N'-(t-бутоксикарбонил)- N1,N4-бис[2-метил-2-(трифенилметилтио)пропил] -1,4-диазанонана в виде желтой пены (99% выход сырого продукта). Этот сырой продукт использовали без дальнейшей очистки.
В одногорлую круглодонную колбу на 250 мл, снабженную мешалкой и обратным холодильником, загрузили 9-фталимидо-N1- (t-бутоксикарбонил)-N1, N4-бис[2-метил-2- (трифенилметилтио)пропил]-1,4-диазанонан (5,50 г, 5.319.43 ммоль) в 25 мл ТГФ. К этому прибавили 100 мл этанола и 5 мл воды. Добавление воды вызвало осаждение исходного вещества из раствора. Прибавляли гидразингидрат (1,2 мл, 24,7 ммоль, 466 мол.%) и кипятили реакционную смесь 2 дня. Реакционную смесь сконцентрировали и распределили между 100 мл воды и таким же количеством 0,25 М K2CO3. Очистка сырого продукта методом жидкостной хроматографии под пониженным давлением (100 г SiO2, CHCl3---> 5% метанола в CHCl3, с предварительной обработкой колонки 200 мл 2% триэтиламина в CHCl3) дала 3,27 г чистого N1-(t-бутоксикарбонил)-N1,N4-бис[2- метил-2-(трифенилметилтио)пропил] -1,4,10- диазадекана в виде желтой пены (выход 68%), Химический анализ очищенного продукта этого интермедиата подтвердил его идентичность; что следует из:
ПМР (300 МГц, CDCl3): δ 0,9(12H, с), 1,2(6H, с), 1,36(9H, с), 2,05 (4H, м), 2,24 (2H, т), 2,31 (2H, т), 2,62 (3H, т), 3,0 (2H, с, уширенный), 3,1 (2H, с, уширенный), 7,2 (18H, м), 7,6(12H, т). Предсказанное FABMS значение МН+ составило 905,5 и оказалось равным 906,5.
F. Синтез [ВАТ] -конъюгированных(S) Cys(aN-Fmoc) (N(Fmoc)-S- (N9-t-бутoкcикapбoнил)-N6, N9-биc[2мeтил-2- (тpифeнилметилтио)пропи] -(6,9-диазанонан-1-ил)цистеина)
а. Синтез (N9-t-бутоксикарбонил)-N6,N9- бис[2-метил-2-(трифенилметилтио)пропил]-6,9-диазанонан-1 -ола) (ВАТ-пентанола)
В круглодонную колбу на 500 мл с ВАТ кислотой (10,4 г, 10,89 ммоль) в 250 мл сухого ТГФ под аргоном прибавляли 12. 1 мл 1 М BH3-ТГФ (12,1 ммоль), причем прибавление производили медленно в течение 5 минут. После прибавления произошло вспенивание. Эту реакционную смесь выдержали при перемешивании в течение ночи. Реакционную смесь разбавили избытком метанола (50 мл) и выдержали при перемешивании еще 2 часа. Раствор сконцентрировали при упаривании и распределили остаток между 200 мл этилацетата, 100 мл лимонной кислоты и 100 мл 1 М KH2PO4. Органический слой отделили и последовательно промыли порциями по 100 мл водой, насыщенным NaHCO3 и раствором соли. Затем промытый органический слой высушили над безводным Na2SO4 и сконцентрировали в белую пену, получив 8,82 г сырого продукта (выход 89%). Химический анализ очищенного продукта этого интермедиата подтвердил его идентичность; что следует из:
ПМР (300 МГц, CDCl3): δ 0,91 (12H, с), 1,2-1,3 (4H, м), 1,38 (9H, с), 1,4-1,6 (4H, M), 2,08 (1H, с), 2,2-2,4 (4H, м), 2,95-3,05 (2H, уширенный), 3,05-3,25 (2H, уширенный), 3,58 (2H, т, J=6), 7,12-7,28 (18H, м), 7,61 (12H, т, J=7).
b. Синтез О-метансульфонил-(N9-t-бутоксикарбонил)- N6,N9-бис[2-метил-2-(трифенилметилтио)пропил] -6,9-диазанонан-1-ола) (ВАТ-мезилата)
В круглодонную колбу на 500 мл с ВАТ - пентанолом (8,80 г, 9,70 ммоль) в 100 мл сухого ТГФ под аргоном прибавили 1,6 мл триэтиламин (11,5 ммоль), после чего при перемешивании прибавили 0,83 мл метансульфонилхлорида (10,7 ммоль). Через несколько минут раствор стал мутно-белым. Перемешивание продолжали всю ночь при комнатной температуре. Раствор сконцентрировали при упаривании и затем распределили его между 100 мл этилацетата и 100 мл 1 М KH2PO4. Этилацетатный слой отделили и промыли 100 мл раствора соли и затем высушили над безводным Na2SO4 и упарили, получив 9,61 г сырого продукта (выход 100%) в виде светлой желтой пены.
с. Синтез S-(N9-t-бутоксикарбонил)-N6,N9 - бис[2-метил-2-(трифенилметилтио)пропил]-6,9-диазанонан-1-ил) цистеина (H-Cys (ВАТ - ОН)
В сцинтилляционной колбе на 20 мл смешали цистеин (1,3 г, 10,7 ммоль), 4 мл 5,4 М метилата натрия (21,6 ммоль) и 5 мл абсолютного метанола. Этот гомогенный раствор прибавили к раствору ВАТ - мезилата (9,57 г, 9,71 ммоль) в 80 мл безводного диметилформамида (ДМФА) и перемешивание продолжали под аргоном в течение ночи при комнатной температуре. Растворители удалили на роторном испарителе в вакууме, а остаток распределили его между 100 мл этилацетата и 100 мл 1 М KH2PO4. Этилацетатный слой отделили, по следовательно промыли порциями по 100 мл насыщенного NaHCO3 и раствора соли, а затем высушили над безводным Na2SO4 и сконцентрировали при упаривании, получив белую пену. Этот продукт не был охарактеризован, а использовался сразу же в следующей синтетической реакции.
d. Синтез N-флуоренилметоксикарбонил-S-(N9-t- бутоксикарбонил)-N6, N9-бис[2-метил-2- (трифенилметилтио)пропил] -6,9-диазанонан-1-ил)цистеина (Fmoc-Cys(ВАТ)-ОН)
Исходили из предложения, что сырой H-Cys (ВАТ)-ОН, полученный, как описано выше, содержит 9,71 ммоль продукта. Полное количество этого сырого продукта растворили в 200 мл ТГФ и 150 мл воды в колбе Эрленмейера на 1 л. К этому гомогенному раствору прибавили 1,34 г К2CO3 (9,72 ммоль), после чего прибавили 3,28 г N-флуоренилметоксикарбонилоксиюукцинимида (9,73 ммоль). Эту реакционную смесь перемешивали в течение ночи при комнатной температуре. Большую часть ТГФ удалили из реакционной смеси на роторном испарителе, а остаток распределили его между 100 мл этилацетата и 100 мл 1 М KH2PO4. Этилацетатный слой отделили и промыли 50 мл раствора соли, высушили над безводным Na2SO4 и сконцентрировали в желтую пену. После хроматографии получили 10,1 г чистого Fmoc - Cys(BAT)-ОН (84% выход из BAT - мезилата). Химический анализ очищенного продукта подтвердил его идентичность; что следует из:
ПМР (300 МГц, CDCl3): δ 0,85 (12H, с), 1,23 (4H, уширенный), 1,35 (9H, с), 1,5 (2H, м), 2,0-2,15 (2H, м), 2,15 - 2,35 (4H, м), 2,51 (2H, т, J=6), 2,85-3,05 (4H, м), 3,15 (2H, уширенный), 4,1-4,2 (1H, м), 4,2-4,4 (3H, м), 7,05-7,4 (22H, м), 7,5-7,65 (14H, м), 7,71 (2H, д, J=7).
ПРИМЕР 2
Твердофазный пептидный синтез
Твердофазный пептидный синтез (ТФПС) проводили в масштабе 0,25 миллимолей (ммоль) с использованием Applied Biosystems Model 431 A Peptide Synthesizer и используя 9-флуоренилметилокси-карбонил (Fmoc) аминотерминальную защиту в сочетании с бицикло-гексилкарбодиимид /гидроксибензотриазолом или 2-(1 Н-бензотриазол-1-ил)-1, 1,3,3- тетраметилуроний гексафторфосфатом/ гидроксибензотриазолом (HBTU/НОВТ) и используя p - гидроксиметил хеноксиметил - полистирольную смолу (НМР), или Sasrin или хиротритильную смолу для карбоксилтерминальных кислот или Rink амидную смолу для карбоксилтерминальных амидов.
Где уместно, Fmoc - Cys (ВАТ) и Nα - Fmoc - Nε - (ВАТ) Lys синтезировали, как описано в примере 1.
Где уместно, 2-хлороацетил, 2-бромоацетил и 2-бром-3-фенилпропионильные группы вводили либо с использованием соответствующей 2 - галогенокислоты, как последнего остатка, соединенного во время ТФПС, или при обработке пептида с N - терминальной свободной аминокислотой, присоединенной к смоле, либо 2 - галогенокислотой /диизопропилкарбодиимидо/N - гидроксисукцинимид/NMP или ангидридом 2-галогенокислоты/диизопропилэтиламин/NMP.
Где уместно, очищенные ЖХВД 2-галогенацилированные пептиды циклизуют при перемешивании 0,1 -1,0 мг/мл раствора в фосфатном или бикарбонатном буфере или разбавляют гидроксидом аммония (pH 8,0), содержащим в случае необходимости 0,5 - 1,0 мМ ЭДТА, или ацетонитрил или ТГФ, в течение 1 - 48 часов с последующим, если это требуется, подкислением уксусной кислотой, лиофилизацией и очисткой ЖХВД.
Где уместно, тиол - содержащие пептиды взаимодействуют с хлорацетилсодержащими, тиол - защищенными Tc - 99m комплексующими составляющими при pH 10 в течение 0,5 - 4 часов при комнатной температуре с последующим подкислением уксусной кислотой и упариванием этого раствора с получением соответствующего пептид-сульфидного аддукта. Снятие защиты и очистку обычно производят, как описано, получая хелатор - пептидный конъюгат.
Где уместно, BSME аддукты получают при взаимодействии тиол-содержащих пептидов (от 5 до 50 мг/мл в ДМФА, забуференном до pH 7 N- метилморфолином или N - этилморфолином, или 50 мМ на-трийфосфатного буфера, pH 7-8, содержащего необязательно 0,5 мМ ЭДТА или ДМФА или ацетонитрил), с 0.5 молярными эквивалентами ВММЕ (бис - малеимидометиловый эфир), предварительно растворенного в ацетонитриле, при комнатной температуре, приблизительно 1 -18 часов. Раствор сконцентрировали и очистили продукт ЖХВД.
Где уместно, TSEA аддукты получали при взаимодействии одного тиол-содержащего пептида (при концентрациях пептида от 10 до 100 мг/мл в ДМФА, забуференном до pH 7 N-метилморфолином или N - этилморфолином, или от 5 до 50 мг/мл пептида в 50 мМ фосфата натрия, pH 7-8, содержащего, в случае необходимости, 0,5 мМ ЭДТА или ДМФА или ТГФ или ацетонитрил), с 0,33 молярными эквивалентами ТМЭА (трис-(2-малеимидоэтил) амина), предварительно растворенного в ацетонитриле или ДМФА, с или без 1 молярным эквивалентом триэтиламина, при комнатной температуре в течение приблизительно 1 - 18 часов. Такие реакционные смеси, содержащие аддукты, концентрировали и затем очищали эти аддукты с использованием ЖХВД.
Где уместно, (ВАМ) (N1,N4 -бис(2- меркапто-2-метилпропил)-1,4,10-триазадекан) конъюгируют к пептиду при первоначальной активации карбоксилата пептида смесью диизопропилкарбодиимид/N-гидроксисукцинимид или HBTU/ НОВТ в ДМФА, NMP или хлористом метилене, после чего происходит связывание в присутствии диизопропиламина. После связывания с конъюгатов снимают защиту, как описано выше.
Где уместно, (ВАТ) (N6,N9 - бис(2-меркапто-2 -метилпропил)-6,9-диазанонановая кислота) включена в пептид в виде защищенных производных аминокислот, таких, как (Nα (Fmoc)-(Nε (N - Вос)-S, S'-бистритил-ВАТ) лизин (полученный из Nα (Fmoc)-лизина и Nε (N - Воc)-S,S'-бистритил-ВАТ, как описано в Примере 2 или в созаявленном U.S. Patent Application Serial N 08/_, включенном ссылкой), или как (N(Fmoc) -S, S'- бистритил-ВАТ) цистеин (полученный, как описано выше в Примере 1 F), во время пептидного синтеза, и затем с него снимают защиту отделения полного пептида с синтетической смолы.
Где уместно, аддукты ВАТ - BS (N-{2-(N',N'-бис(2-сукцинимидоэтил) аминоэтил)} -N6, N9-бис(2-метил-2-меркаптопропил)-6,9- диазанонанамида) получают при взаимодействии одного тиол - содержащего пептида (при концентрациях пептида от 2 до 50 мг/мл в ДМФА, забуференном до pH 7 N- метилморфолином или N - этилморфолином, или в 50 мМ фосфата натрия, (pH 7-8), содержащего, в случае необходимости, 0,5 мМ ЭДТА или ДМФА, или ТГФ, или ацетонитрил) с 0,5 молярными эквивалентами ВАТ - ВМ (N-{2-(N',N'-бис(2-малеимидоэтил)аминоэтил)} - N9- (t-бутоксикарбонил)-N6,N9-бис(2-метил-2- трифенилметилтиопропил)-6,9-диазанонанамида), предварительно растворенного в ацетонитриле или ДМФА, при комнатной температуре в течение приблизительно 1 - 18 часов. Раствор затем упаривают досуха и снимают защиту с (ВАТ - BS) -пептидных конъюгатов при обработке их 10 мл ТФК и 0,2 мл триэтилсилана в течение 1 часа. Раствор концентрируют, аддукты высаживают эфиром и очищают ЖХВД.
Где уместно, предшественников пептидов циклизуют (между амино- и карбоксильными терминальными группами) по реакции N-терминального свободного амина с защищенной боковой цепью и терминальной свободной кислоты с дифенилфосфорилазидом.
Связанные со смолой Sasrin пептиды снимают, используя раствор 1% ТФК в дихлорометане, получая при этом защищенный пептид. Где уместно, предшественников пептидов циклизуют между амино- и карбоксильными терминальными группами по реакции амино-терминального свободного амина с защищенной боковой цепью и карбоксил-терминальной свободной кислоты с использование дифенилфосфорилазида.
Продукты, связанные с НМР или Rink амидными смолами, обычно отделяют, и снимают защиту с защищенных циклизованных пептидов, используя раствор, содержащий трифторуксусную кислоту (ТФК) или ТФК и хлористый метилен, содержащий необязательно воду, тиоанизол, этандитиол и триэтилсилан или триизопропилсилан в соотношениях 100: 5:5:2,5:2 в течение 0,5 - 3 часов при комнатной температуре. Где уместно, продукты были повторно S - тритилированы в трифенолметаноле /ТФК и N - Boc группы повторно введены в пеп- тид при использовании (Boc)2O.
Сырые пептиды очищают препаративной жидкостной хроматографией под высоким давлением (ЖХВД) с использованием колонки Waters Delta Pak C18 и градиентного элюирования с использованием 0,1% трифторуксусной кислоты (ТФК) в воде, к которой добавлен ацетонитрил. Ацетонитрил упаривают из элюированных фракций, которые затем лиофилизируют. Идентичность каждого продукта подтверждают методами масс - спектрометрии бомбардировки быстрыми атомами (FABMS) или масс - спектрометрии электронного пучка (ESMS).
Рецептор - связывающие вазоактивные кишечные пептиды, производные и аналоги, синтезированные, как обеспечено здесь, а также продукты такого синтеза, идентифицированные методом FABMS, представлены в Таблице 1.
ПРИМЕР 3
Общий способ мечения Tc - 99m
0,1 мг пептида, полученного, как описано в Примере 2, растворили в 0,1 мл или 0,2 мл воды или 0,9% раствора соли. Tc - 99m глюцептат был получен при помещении 0,25 мл Tc - 99m пертехнетата натрия, содержащего до 200 мКи в сосуд Glucoscan (Е.I. DuPont de Nemours, Inc., Wilmington, DE) и выдерживании его в течение 15 ми нут при комнатной температуре. Затем к пептиду добавили 25 мкл Tc - 99m глюцептата и оставили реакцию протекать при комнатной температуре или 100oC в течение 15 или 55 минут, а затем от фильтровали через фильтр 0,2 мкм.
Чистоту меченного Tc - 99m пептида определили методом обращеннофазовой ЖХВД с использованием следующих условий: Walters Delta Pak C-18, 5 μ , 3,9 мм x 150 мм аналитическую колонку загрузили каждым из меченых пептидов и элюировали пептиды растворителем со скоростью протекания 1 мл/мин (Delta Pak). Градиент элюирования осуществляли, используя градиент 20 - 50% растворитель В / растворитель А (растворитель A-0,1% CF3COOH в воде, растворитель В-0,1% CF3COOH в 90/10 CH3CN/H2O) в течение 20 минут с последующим элюированием 100% В/А в течение 3 минут.
Радиоактивные компоненты определяли, используя встроенный радиометрический детектор, связанный с интегратором. Tc - 99m глюцептат и Tc - 99m пертехнетат элюируют в течение от 1 до 4 минут при этих условиях, тогда как меченные Tc - 99m пептиды элюируют за значительно более длительное время. Пептиды определяли встроенным спектрофотометрическим определением при 220 нм.
Нерадиоактивные рениевые комплексы получали со - растворением каждого из пептидных реагентов изобретения с около одним эквивалентом оксотетрабромрената (+ 5) тетрабутиламмония, полученного, как описано у Cotton et al., (Inorg. Chem. 5: 9-16), в диметилформамиде или смеси ацетонитрил/вода и при перемешивании в течение 0,5 - 5 дней. Рениевые комплексы выделяли обращеннофазовой ЖХВД, как описано выше для Tc - 99m меченых пептидов, и были охарактеризованы методами FABMS и ESMS. Нерадиоактивные пептиды определяли как пептиды встроенным спектрофотометрическим определением при 220 нм.
Радиоактивные рениевые комплексы, например, Re-186 или Re-188, получают из соответствующих солей перрената с использованием той же процедуры, что и для мечения Tc - 99m, или при добавлении восстанавливающего агента к раствору пептида и перрената, или используя по выбору такой переносчик лиганда, как цитрат и выдерживая реакцию при температуре между комнатной температурой и 100oC от 5 до 60 минут.
Результаты очистки пептидов, Tc - 99m меченых пептидов и пептидов, образующих комплекс с ReO методом ЖХВД представлены в Таблице II.
ПРИМЕР 4
Биологические пробы
Пептиды изобретения или их комплексы с ReO были исследованы на биологическую активность в сравнительных биологических пробах с меченым 125I ВКП.
Такие пробы осуществляют в стандартной пробе связывания ВКП с использованием мембран, выделенных из легкого морской свинки; на периферических моноцитах крови и тромбоцитах и на множестве клеточных линий человеческой опухоли.
В практике этих способов, ВКП радиойодируют с использованием йодогенного метода, как описано у Schanen et al., (1991, Lancet 6: 395-396). Кратко, 50 мкг ВКП в 10 мкл 0,5 М фосфатного буфера (pH 7,5), необходимое количество радиоактивного изотопа и 6 мкг йодогена выдерживали при комнатной температуре около 30 минут при осторожном перемешивании. Радиойодированные ВКП очищали от невключенного радиоактивного изотопа йода методом ЖХВД и растворяли в солевом фосфатном буфере (СФБ), в который добавили 0,1% человеческого сывороточного альбумина и 0,1% детергента Tween - 80.
В пробах с использованием выделенных мембран из легкого морской свинки, легкие взяли у самца морской свинки, а мембраны выделяли так, как описано у Carstairs and Barnes (1986, J. Pharmacol. Exp. Ther. 239: 249 - 255, включенном ссылкой). 0,2 мг препарата мембраны выдержали с 0,01 нМ меченного 125I ВКП в присутствии или в отсутствие меняющихся концентраций пептидов изобретения или их комплексов с ReO. Из сравнения степени связывания в присутствии или в отсутствие немеченых соединений ВКП, определяли концентрацию каждого соединения, соответствующую ингибированию меченного 125I ВКП, связанного на 50% (определяемую как IC50).
Результаты для каждого из протестированных соединений с использованием этих процедур представлены в Таблице 3. Эти результаты указывают на то, что пептиды и ReO комплексы пептидов изобретения являются потенциальными ингибиторами связывания ВКП с мембранами легкого, выражающими рецептор ВКП.
Похожие эксперименты осуществили с использованием нормальных периферических человеческих тромбоцитов и моноядерных клеток.
В этих экспериментах, тромбоциты выделяли по методу Virgolini et al., (1990, Brit. J. Cancer 12:849-861). Периферические моноядерные клетки (ПМЯК) выделили из цельной защитной оболочки крови центрифугированием с градиентом плотности по Ficoll (= 1,077). Перед пробой клетки промывали 50 мМ трис-HCl, буфером, pH 7,5 и затем ресуспендировали в тот же буфер, в который добавили 5 мМ MgCl2, 1 мМ CaCl2 и 0,1 М NaCl. Использовали около 5 x 107 клеток на пробу.
Результаты этих проб с использованием тромбоцитов и ПМЯК, представленные в Таблице IV, показывают, что ReO комплексы пептидов изобретения являются потенциальными антагонистами к вазоактивному кишечному рецепторному связыванию с этими периферическими кровяными клетками.
С использованием описанной выше связывающей сравнительной пробы были исследованы следующие опухолевые клеточные линии: клетки KU812 (клеточная линия человеческой хронической миелогенной лейкемии); клетки COLO320 (клеточная линия человеческой аденокарциномы толстой кишки); клетки HT29 (клеточная линия человеческой кишечноректальной аденокарциномы); клетки PANCI (клеточная линия человеческой панкреатической аденокарциномы); клетки НМCI (мастовые человеческие клетки). Каждая клеточная линия была исследована в сущности как описано выше для человеческих периферических кровяных клеток. Клетки были выращены в среде RPMI или в модифицированной среде Дульбекко (клетки НМCI), к которой добавили 10% фетальную телячью сыворотку, глутамин и антибиотики, с использованием стандартных методов культивирования клеток (см. Animal Cell Culture: A Practical Approach, Freshney, ed, IRL Press: Oxford, UK. 1992).
Результаты этих проб, представленные в Таблице V показывают, что ReO комплексы пептидов изобретения являются потенциальными ингибиторами вазоактивного кишечного рецепторного связывания с этими опухолевыми клетками.
Эти результаты показывают, что вазоактивные кишечные пептиды и их ReO комплексы, обеспеченные этим изобретением, способны специфически связываться с вазоактивными кишечными рецепторами в стандартных пробах in vitro на различных типах нормальных и человеческих опухолевых клеток. Эти результаты указывают на то, что вазоактивные кишечные пептиды изобретения полезны в качестве сцинтиграфических отображающих агентов для отображения участков опухоли на людях.
Эти пробы были использованы для выбора рентгенотерапевтических агентов, что обеспечено изобретением, где in vitro вазоактивные кишечные рецептор - экспрессирующие клетки и мембраны использовали для того, чтобы определить и количественно оценить связывание вазоактивных кишечных рецепторов ReO закомплексованных реагентов изобретения, включающих вазоактивные кишечные пептиды, ковалентно связанные с хелатирующей составляющей, включенной в реагент во время пептидного синтеза. Такие Re - закомплексованные реагенты затем могут быть оценены в сравнительных связывающих пробах, как здесь описано, с использованием радиойодированного вазоактивного кишечного материала.
Следует понять, что в предстоящем раскрытии делается акцент на некоторые специфические воплощения изобретения и что все модификации и эквивалентные изменения к нему соответствуют характеру и масштабу изобретения, как установлено далее в прилагаемой формуле изобретения.
Формула изобретения: 1. Реагент для получения радиофармацевтического препарата, включающий синтетический, рецептор-связывающий вазоактивный кишечный пептид (VIP), ковалентно связанный с хелатирующей составляющей технеция или рения, где упомянутую хелатирующую составляющую вводят в реагент во время синтеза пептида и где меченный технецием или рением радиофармацевтический препарат обладает сродством к связыванию рецептора VIP, которое составляет не менее, чем около одной десятой сродства радиойодированного природного VIP к указанному рецептору.
2. Реагент по п.1, где пептид имеет аминокислотную последовательность, выбранную из группы, состоящей из
SDAVFTDNYTRLRKQMAVKKYLNSILN.амида;
-NYTRLRKQMAVKKYLNSILN.амида и
-KQMAVKKYLNSILN.амида
и где хелатирующая составляющая включена в реагент у боковой цепи аминокислоты в указанной последовательности или у конца пептида.
3. Реагент по любому из п.1 или 2, где хелатирующая составляющая имеет формулу, выбираемую из группы, состоящей из
I.
C(pgp)s-(aa)-C(pgp)s,
где (pgp)s представляет собой H или тиоловую защитную группу;
(aa) является первичной α- или β-аминокислотой;
II. хелатирующей составляющей, состоящей из единственной тиоловой составляющей, имеющей формулу
A-CZ(B)-{C(R1R2)}n-X
где A является H, HOOC, H2NOC, (аминокислота или пептид) - HNOC, (аминокислота или пептид) - OOC или R4;
B является H, SH, -NHR3, -N(R3) - (аминокислота или пептид) или R4;
X является H, SH, -NHR3, -N(R3) - (аминокислота или пептид) или R4;
Z является H или R4;
R1, R2, R3 и R4 являются независимо H или низшим линейным или разветвленным или циклическим алкилом;
n = 0, 1 или 2;
(пептид) представляет собой пептид, включающий от 2 до 10 аминокислот; и
где B является -NHR3 или -N(R3) - (аминокислота или пептид), X является SH и n = 1 или 2;
где X является -NHR3 или -N(R3) - (аминокислота или пептид), B является SH и n = 1 или 2;
где B является H или R4, A является HOOC, H2NOC, (аминокислота или пептид) -NHOC, (аминокислота или пептид) -OOC, X является SH и n = 0 или 1;
где A является H или R4, тогда где B является SH, X является NHR3 или -N(R3) - (аминокислота или пептид) и где X является SH, B является -NHR3 или -N(R3) - (аминокислота или пептид), и n = 1 или 2;
где X является H или R4, A является HOOC, H2NOC, (аминокислота или пептид) -NHOC, (аминокислота или пептид) -OOC, B является SH;
где Z является метилом, X является метилом, A является HOOC, H2NOC, (аминокислота или пептид) -NHOC, (аминокислота или пептид) -OOC, B является SH и n = 0;
и где тиоловая составляющая находится в восстановленной форме и (аминокислота) является любой первичной α- или β-аминокислотой, не содержащей тиоловой группы;
III.

где каждый R является независимо H, CH3, или C2H5;
каждая (pgp)s является независимо тиоловой защитной группой или H;
m, n и p равны независимо 2 или 3;
A = линейный или циклический низший алкил, арил, гетероциклил, их комбинации или замещенные производные;
IV.

где каждый R является независимо H, CH3, или C2H5;
m, n, и p равны независимо 2 или 3;
A является линейным или циклическим низшим алкилом, арилом, гетероциклилом, их комбинацией или замещенными производными;
V представляет собой H или CO-пептид;
R' является H или пептидом;
и в случае, когда V является H, R' представляет собой пептид, и когда R' является H, V представляет собой -CO-пептид;
моноаминная, диаминная, монотиоловая группы, имеющие формулу

где n, m и p является каждое независимо 0 или 1;
каждый R' является независимо H, низшим алкилом, гидроксиалкилом (C2-C4), или алкоксиалкилом (C2-C4);
каждый R является независимо H или R'', где R'' представляет собой замещенный или незамещенный низший алкил или фенил, не содержащий тиоловую группу;
один R или R' является L, в случае, когда R' является L, -NR'2 является амином; и L представляет собой двухвалентную связывающую группу, соединяющую радиоактивно меченную связывающую составляющую с пептидом;
моноаминная, диамидная, монотиоловая группы, имеющие формулу

где n, m, и p является каждое независимо 0 или 1;
каждый R' является независимо H, низшим алкилом, гидроксиалкилом (C2-C4), или алкоксиалкилом (C2-C4);
каждый R является независимо H или R'', где R'' представляет собой замещенный или незамещенный низший алкил или фенил, не содержащий тиоловую группу;
один R или R' является L, в случае, когда R' является L, -NR'2 является амином; и L представляет собой двухвалентную связывающую группу, соединяющую радиоактивно меченную связывающую составляющую с пептидом.
4. Реагент по п.3, где хелатирующая составляющая является единственной тиол-содержащей составляющей, выбранной из группы, состоящей из:
(аминокислота)1-(аминокислота)2-{A-CZ(B)-{C(R1R2)}n-X};
-{A-CZ(B)-{C(R1R2)}n-X} - (аминокислота)1-(аминокислота)2;
-(первичная α,β- или β,γ-диаминокислота) - (аминокислота)1 - {A-CZ(B)-{ C(R1R2)}n-X};
-{ A-CZ(B)-{ C(R1R2)} n-X} - (аминокислота)1 - (первичная α,β- или β,γ-диаминокислота);
(аминокислота)1-(аминокислота)2-цистеин-;
(аминокислота)1-(аминокислота)2-изоцистеин-;
(аминокислота)1-(аминокислота)2-гомоцистеин-;
(аминокислота)1-(аминокислота)2-пеницилламин-;
(аминокислота)1-(аминокислота)2-2-меркаптоэтиламин-;
(аминокислота)1-(аминокислота)2-2-меркаптопропиламин-;
(аминокислота)1-(аминокислота)2-2-меркапто-2-метилпропиламин-;
(аминокислота)1-(аминокислота)2-3-меркаптопропиламин-;
-цистеин-(аминокислота)-α,β- или β,γ-диаминокислоты);
-изоцистеин-(аминокислота)-(α,β- или β,γ-диаминокислоты);
-гомоцистеин-(аминокислота)-(α,β- или β,γ-диаминокислоты);
-пеницилламин-(аминокислота)-(α,β- или β,γ-диаминокислоты);
-2-меркаптоуксусная кислота-(аминокислота)-(α,β- или β,γ-диаминокислоты);
-2- или 3-меркаптопропионовая кислота-(аминокислота)-(α,β- или диаминокислоты);
-2-меркапто-2-метилпропионовая кислота-(аминокислота)-(α,β- или β,γ-диаминокислоты);
Gly - Gly - Cys -,
Ala - Gly - Cys -,
-(ε - Lys) - Gly - Cys -,
-(δ - Orn) - Gly - Cys -,
-(γ - Dab) - Gly - Cys -,
-(β - Dap) - Gly - Cys -,
- Cys (ВАТ),
где (аминокислота) является первичной α- или β-аминокислотой, не содержащей тиоловой группы.
5. Реагент по п.3, где хелатирующая составляющая является моноамином, диамином, монотиолом, выбранным из группы, состоящей из

где R1 и R2 являются каждый независимо H, низшим алкилом, гидроксиалкилом (C2-C4) или алкоксиалкилом (C2-C4);
R3, R4, R5 и R6 представляют собой независимо H, замещенный или незамещенный низший алкил или фенил, не содержащий тиоловую группу;
R7 и R8 представляют собой независимо H, низший алкил, низший гидроксиалкил или низший алкоксиалкил;
L является двухвалентной связывающей группой;
Z является пептидом,

где R1 и R2 являются каждый независимо H, низшим алкилом, гидроксиалкилом (C2-C4) или алкоксиалкилом (C2-C4);
R3, R4, R5 и R6 представляют собой независимо H, замещенный или незамещенный низший алкил или фенил, не содержащий тиоловую группу, и один из R3, R4, R5 и R6 является Z-L-(CR2)n-, где n - целое число от 1 до 6 и каждый R является независимо H, низшим алкилом или замещенным низшим алкилом;
R7 и R8 являются каждый независимо H, низшим алкилом, низшим гидроксиалкилом или низшим алкоксиалкилом;
L является двухвалентной связывающей группой;
Z является пептидом;
X является - NH2, - NR2R2 или - NR1 - Y, где Y-аминокислота, амид аминокислоты или пептид, включающий от 2 до 20 аминокислот,

где R1 и R2 являются каждый независимо H, низшим алкилом, гидроксиалкилом (C2-C4) или алкоксиалкилом (C2-C4);
R3, R4, R5 и R6 представляют собой независимо H, замещенный или незамещенный низший алкил или фенил, не содержащий тиоловую группу;
X является - NH2, - NR1R2 или - NR1 - Y, где Y-аминокислота, амид аминокислоты или пептид, включающий от 2 до 20 аминокислот;
n является целым числом от 1 до 6;
L является двухвалентной связывающей группой;
Z является пептидом,

где L является связывающей группой;
Z является пептидом.
6. Реагент по п.1, имеющий формулу, выбираемую из группы, состоящей из
HSDAVFTDNYTRLRKQMAVKKYLNSILN(ε-K)GC.амида;
HSDAVFTDNYTRLRKQMAVKKYLNSILNGGC.амида;
AGCHSDAVFTDNYTRLRKQMAVKKYLNSILN.амида и
HSDAVFTDNYTRLRKQMAVKKYLNSILNC(BAT).амида(SEQ ID NO:4).
7. Сцинтиграфический отображающий агент, включающий реагент по любому из пп.1 - 6 и технеций 99m.
8. Способ отображения участка внутри тела млекопитающего, включающий этапы введения эффективного диагностического количества агента по п.7 и определение технеций -99m, локализованного на участке в теле млекопитающего.
9. Радиотерапевтический агент, включающий реагент по любому из п.1 - 6 и цитотоксический радиоизотоп, выбираемый из группы, состоящей из рения-186 и рения-188.
10. Способ радиотерапии животного, страдающего связанным с VIP заболеванием, характеризующимся ростом злокачественных и доброкачественных опухолей, которые способны связать VIP или аналоги VIP через рецептор VIP, экспрессируемые на поверхности клеток в указанных опухолях, включающий стадию назначения животному эффективного терапевтического количества агента по п.9.
11. Набор для получения радиофармацевтического препарата, причем упомянутый набор включает в себя запечатанную ампулу, содержащую определенное заранее количество реагента по любому из пп.1 - 6 и достаточное количество восстанавливающего агента для мечения реагента технецием-99m, рением-186 или рением-188.