Главная страница  |  Описание сайта  |  Контакты
Патент на изобретение №2457862

(19)

RU

(11)

2457862

(13)

C1

(51) МПК A61K39/395 (2006.01)

(12) ОПИСАНИЕ ИЗОБРЕТЕНИЯ К ПАТЕНТУ Статус: по данным на 27.08.2012 - действует Пошлина:

(21), (22) Заявка: 2011112433/15, 07.07.2011

(24) Дата начала отсчета срока действия патента:

07.07.2011

Приоритет(ы):

(22) Дата подачи заявки: 07.07.2011

(45) Опубликовано: 10.08.2012

(56) Список документов, цитированных в отчете о

поиске: RU 2408728 C1, 10.01.2011. US 20070042964 A1, 22.02.2007. БАКЛАУШЕВ В.П. Иммунофлюоресцентный анализ коннексина-43 на основе моноклональных антител к его экстраклеточному домену. Клеточные технологии в биологии и медицине. 2009, 236-241. PONSAERTS R. ET AL. Intramolecular loop/tail interactions are essential for connexin 43-hemichannel activity, The FASEB Journal, 2010, v.24, 11, p.4378-4395.

Адрес для переписки:

119991, Москва, ГСП-1, Кропоткинский пер., 23, ФГУ "ГНЦССП им. В.П. Сербского" Минзравсоцразвития России, научно-организационный отдел

(72) Автор(ы):

Чехонин Владимир Павлович (RU),

Юсубалиева Гаухар Маратовна (RU),

Баклаушев Владимир Павлович (RU),

Гурина Ольга Ивановна (RU)

(73) Патентообладатель(и):

Федеральное государственное учреждение "Государственный научный центр социальной и судебной психиатрии им. В.П. Сербского" Министерства здравоохранения и социального развития Российской Федерации (RU)

(54) СПОСОБ ЛЕЧЕНИЯ НИЗКОДИФФЕРЕНЦИРОВАННЫХ ГЛИОМ

(57) Реферат:

Изобретение относится к области медицины, а именно к экспериментальной и прикладной нейробиологии и нейроонкологии, используется для терапии низкодифференцированных глиом и профилактики послеоперационных рецидивов. Способ лечения низкодифференцированных глиом включает введение стандартизированного препарата анти-Сх43 антител, полученных к рекомбинантному фрагменту коннексина-43 Q173-1208 с аминокислотной последовательностью QWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTI. Препарат анти-Сх43 антител вводится в количестве не менее 5 мг/кг веса реципиента один раз каждые 5-7 дней до достижения терапевтического эффекта. Способ позволяет замедлить рост опухоли и увеличить продолжительность жизни пациента на фоне проводимой терапии низкодифференцированных глиом. 3 з.п. ф-лы, 4 ил., 2 пр.

Изобретение относится к области медицины, а именно к экспериментальной и прикладной нейробиологии и нейроонкологии, и может быть использовано для терапии низкодифференцированных глиом и профилактики послеоперационных рецидивов.

Низкодифференцированные глиомы составляют 40-45% от нейроонкологических заболеваний. В большинстве случаев прогноз для пациентов со злокачественными глиомами крайне неблагоприятен. Активная миграция глиомных клеток исключает радикальную хирургию глиобластомы, в результате чего рецидив опухолевого роста после хирургического лечения неизбежен, несмотря на агрессивное послеоперационное применение адъювантной лучевой терапии и/или химиотерапии.

Внедрение в терапию онкологических заболеваний препаратов на основе моноклональных антител привело к увеличению продолжительности жизни на фоне проводимой терапии.

Одним из белков выбора в качестве антигена-мишени для проведения терапии низкодифференцированных глиом является белок щелевых контактов (Huang R., et al., 2002, Oliveira R., et al. 2005) - коннексин-43. Коннексин-43 (Cx43, CXA1_RAT) - интегральный мембранный белок, образующий щелевые межклеточные контакты (gap-junction) между астроцитами в дефинитивной нервной ткани, а также между кардиомиоцитами и клетками проводящей системы сердца. Существуют экспериментальные данные, показывающие активирующее влияние Сх43 на процессы инвазии мультиформной глиобластомы человека и ее аналога у крыс - экспериментальной глиомы С6 (Fu СТ, et al., 2004). В этой связи весьма актуальным является проведение терапии низкодифференцированных глиом с помощью анти-Сх43 антител.

При анализе существующего технического уровня не выявлены решения, аналогичные заявляемому способу лечения низкодифференцированных глиом с помощью анти-Сх43 антител.

Целью изобретения является разработка способа лечения низкодифференцированных глиом путем применения стандартизованного препарата анти-Сх43 антител.

Технический результат заключается в том, что на фоне проводимой терапии низкодифференцированных глиом замедляется рост опухоли и увеличивается продолжительность жизни пациента.

Технический результат достигается в заявленном способе лечения низко-дифференцированных глиом, включающем введение стандартизированного препарата анти-Сх43 антител (константа диссоциации [Kd]=9×10 -10 М), полученного к рекомбинантному фрагменту коннексина-43 Е2 Сх43 Q173 - I208 с аминокислотной последовательностью QWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTI (36 а.о., M.w. 4,28 кДа, pl=7,87), при котором препарат анти-Сх43 антител вводят в количестве не менее 5 мг/кг веса реципиента один раз каждые 5-7 дней до достижения терапевтического эффекта.

Стандартизованный препарат анти-Сх43 антител вводят с момента обнаружения низкодифференцированной глиомы или после оперативного удаления глиомы.

Стандартизованный препарат анти-Сх43 антител вводят путем внутривенной инфузии.

Способ осуществляют следующим образом.

Моноклональные антитела получают с помощью традиционной гибридомной технологии с некоторыми модификациями [Чехонин В.П., 2007] в результате иммунизации препаратом рекомбинантного экстраклеточного фрагмента Сх43 (Q173-I208) [Баклаушев В.П. и соавт. 2009]. Сх43-позитивные клоны гибридом продуцирующие анти-Сх43 антитела отбирают с помощью иммуноцитохимического анализа на живой (нефиксированной) культуре клеток линии глиомы С6.

Препарат анти-Сх43 антител, подготовленный для терапии низкодифференцированных глиом, охарактеризовывают следующим образом.

При изучении свойств анти-Сх43 антител, выделенных из среды культивирования in vitro и из асцитных жидкостей при выращивании продуцентов in vivo, установлено, что они принадлежат к классу IgG. Изотипирование анти-Сх43 антител методом непрямого иммуноферментного анализа с применением коммерческих антисывороток, коньюгированных с пероксидазой хрена (Sigma, USA) показало, что они относятся к субклассу lgG2b.

Константу аффинности анти-Сх43 антител при связывании с очищенным фрагментом Сх43 определяют по методу J. David Beatty («Measurement of monoclonal antibody affinity by non-competitive enzyme immunoassay» 1987). Вычисляют по формуле K aff =1/(4[Ab']-2[Ab]), где [Ab'] - концентрация антител, соответствующая 50% связыванию от максимального при внесении в лунку планшета очищенного рекомбинантного фрагмента коннексина 43 в концентрации [Ag], а [Ab] - концентрация антител, соответствующая их 50% связыванию от максимального при внесении белка в концентрации 2×[Ад] в лунку. Константа диссоциации, обратно пропорциональная K aff , составила [Kd]=9×10 -10 М.

С целью определения специфичности к антигену Сх43, их функциональной активности и рабочей концентрации очищенные анти-Сх43 антитела из отобранного клона гибридных клеток тестируют иммуногистохимически на срезах головного мозга крыс с глиомой С6.

Для определения способности полученных анти-Сх43 антител распознавать белок щелевых контактов Сх43 в нативной конформации их тестируют на живой (нефиксированной) культуре клеток глиомной линии С6 крысы и человека U2581 с целью визуализации плакоидных структур на мембране клеток глиомной линии.

С целью определения способности полученных анти-Сх43 антител длительно циркулировать в крови, а также взаимодействовать с антигеном-мишенью при внутривенном введении, анти-Сх 43 антитела коньюгируют с радиоизотпной или флюоресцентной меткой Alexa 660 (Invitrogen. USA) и вводят в системный кровоток крысы с имплантированной глиомой С6 или U251. Регистрируют либо накопление радиоактивной метки в зонах экспрессии нужного антигена мишени, либо визуализируют флюоресценцию антител, связавшихся антигеном-мишенью, презентированным в структурах периопухолевого пространства.

Только суммарный иммунохимический анализ препаратов анти-Сх43 антител позволяет сделать вывод об их специфичности и пригодности для применения in vivo.

Препарат анти-Сх43 антител перед применением разводят в физиологическом буфере до конечной концентрации не менее чем 1 мг/мл. Для достижения терапевтического эффекта в лечении низкодифференцированных глиом препарат назначают в количестве не менее чем 5 мг/кг веса реципиента. Повторяют инъекции препарата каждые 5-7 дней до наступления терапевтического эффекта

Терапевтический эффект оценивают, базируясь на двух основных параметрах: 1) по уменьшению объема глиомы (по результатам контрольного МРТ сканирования головного мозга с морфометрией объема опухоли) и 2) по увеличению продолжительности жизни на фоне проводимой терапии.

Изобретение поясняется фигурами. На фиг.1 показан анализ выживаемости по методу Каплан Мейера. На фиг.2 показаны суммарные данные морфометрии. На фиг.3 изображена глиома С26 на 25 сутки после имплантации, на фиг.4 - глиома С6 на 42 сутки после имплантации, после терапии стандартизованным препаратом анти-Сх43 антител.

Для доказательств возможности осуществления предложенного способа с достижением заявленного назначения и указанного технического результата приводим следующие примеры.

ПРИМЕР 1

Широко известно, что по морфологии, характеру инвазивного роста и спектру экспрессируемых белков глиома С6 очень близка мультиформной глиобластоме человека, чем объясняется ее широкое применение для моделирования глиобластомы человека на крысах (Auer RN., et al. A simple and reproducible experimental in vivo glioma model. Can J Neurol Sci 1981; 8:325-331). Спектр экспрессируемых клетками глиомы С6 белков включает белки базальной мембраны, белки клеточной адгезии и тканевые протеолитические ферменты, обеспечивающие деградацию межклеточного матрикса в процессе инвазии, сигнальные белки, факторы роста и их рецепторы, поддерживающие высокий уровень пролиферации опухолевых клеток и стимулирующие ангиогенез (Grobben В., De Deyn (2002) Rat С6 glioma as experimental model system for the study of glioblastoma growth and invasion. // Cell Tissue Res. 310, p.257-270).

Для моделирования глиобластомы применили методику стереотаксической имплантации предварительно культивированных глиомных клеток в стриатум мозга крысы (Чехонин В.П., Баклаушев В.П., Юсубалиева Г.М., 2007) (фиг.4).

Тридцати крысам имплантировали методом стереотаксиса глиомные клетки линии С6 крысы в количестве 5*10 5 . Из них 10-ти крысам на 5-е сутки после имплантации глиомы С6 под кетаминовым наркозом в кровеносное русло вводили препарат анти-Сх43 антител, подготовленный для терапии низкодифференцированных глиом (5 мг препарата на 1 кг веса).

Десять крыс с имплантированной глиомой С6 (контрольная группа) получили препарат неспецифических иммуноглобулинов IgGm в том же количестве. Оставшиеся 10 крыс не получали никакой терапии. Проводилось еженедельное введение препарата в той же дозировке до момента гибели контрольных животных.

Терапевтический эффект препарата анти-Сх43 антител оценили по уменьшению объема опухоли на фоне проводимой терапии.

Опытные группа и группа контроля и сравнения крыс с экспериментальной глиомой в ходе проведения эксперимента были подвергнуты еженедельному МРТ сканированию головного мозга с последующей морфометрией растущей опухоли. Результаты динамической морфометрии и статистический анализ полученных данных свидетельствуют о достоверном замедлении роста глиомы на фоне проведенной терапии анти-Сх43 антителами (фиг.1). Объем экспериментальной глиомы крыс, получивших терапию анти-Сх43 антителами в два раза меньше по сравнению с объемом опухоли крыс в контрольных группах.

В ходе исследования, по данным полученной морфометрии, отмечено, что крысы с экспериментальной глиомой С6, получавшие внутривенные инъекции препарата неспецифических иммуноглобулинов и крысы с глиомой без терапии (группы контроля и сравнения) не отличаются по размерам внутримозговой глиомы, что исключает какое-либо неспецифическое влияние введенных в кровоток крыс с глиомой неспецифических иммуноглобулинов.

ПРИМЕР 2

Тридцати крысам имплантировали методом стереотаксиса глиомные клетки линии С6 крысы в количестве 5*10 5 (моделирование глиобластомы).

Стандартизованный препарат анти-Сх43 антител, подготовленный для терапии низкодифференцированных глиом (5 мг препарата на 1 кг веса), под кетаминовым наркозом вводили в кровеносное русло 10-ти крысам на 5-е сутки после имплантации глиомы С6.

Десять крыс с имплантированной глиомой С6 (контрольная группа) получили препарат неспецифических иммуноглобулинов IgGm в том же физиологическом растворе и аналогичной дозировке. Оставшиеся 10 крыс не получали никакой терапии. Проводилось еженедельное введение препарата в той же дозировке до момента гибели контрольных животных.

Терапевтический эффект препарата анти-Сх43 антител оценили по увеличению продолжительности жизни крыс с глиомой С6 на фоне проводимой терапии в опытной по сравнению с крысами с глиомой С6 контрольных групп.

Для анализа выживаемости крыс с экспериментальной глиомой на фоне терапии анти-Сх43 антителами и в контрольной группе была применена процедура Каплан Майера (определение функции выживаемости крыс с глиомой в опытной и контрольных группах с использование статистического пакета Statica 6,0).

Как видно из приведенного графика (фиг.2), отражающего функцию выживаемости крыс с глиомой, крысы опытной группы, получавшие терапию анти-Сх43 антителами в дозе 5 мг на кг веса, достоверно переживали крыс с глиомой обеих контрольных групп. Несколько крыс с глиомой С6 полностью выздоровели и по истечению времени воспроизвели новое потомство. У этих крыс имплантированная глиома регрессировала на фоне проведенной терапии анти-Сх43 антителами, без рецидивирования, несмотря на последующие после выздоровления перенесенную беременность, роды и вскармливание.

Во всех случаях, системное введение анти-Сх43 антител в вышеуказанной дозировке приводило либо к достоверному увеличению продолжительности жизни, по сравнению с контрольными животными, либо к полному выздоровлению крысы (исчезновение опухоли) (фиг.3, 4).

Формула изобретения

1. Способ лечения низкодифференцированных глиом, включающий введение стандартизированного препарата анти-Сх43 антител, полученных к рекомбинантному фрагменту коннексина-43 Q173-1208 с аминокислотной последовательностью QWYIYGFSLSAVYTCKRDPCPHQVDCFLSRPTEKTI, при котором препарат анти-Сх43 антител вводят в количестве не менее 5 мг/кг веса реципиента один раз каждые 5-7 дней до достижения терапевтического эффекта.

2. Способ по п.1, отличающийся тем, что стандартизованный препарат анти-Сх43 антител вводят с момента обнаружения низкодифференцированной глиомы.

3. Способ по п.1, отличающийся тем, что стандартизованный препарат анти-Сх43 антител вводят после оперативного удаления глиомы.

4. Способ по п.1, отличающийся тем, что стандартизованный препарат анти-Сх43 антител вводят путем внутривенной инфузии.

РИСУНКИ